Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4409
Gene name
Locationscaffold_35:27909..29988
Strand-
Gene length (bp)2079
Transcript length (bp)1962
Coding sequence length (bp)1959
Protein length (aa) 653

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.0E-34 168 557
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 4.4E-12 219 570

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 168 625 2.0E-73
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 167 651 7.0E-45
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 162 651 3.0E-42
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 169 570 2.0E-39
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 162 635 5.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 168 625 2.0E-73
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 167 651 7.0E-45
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 162 651 3.0E-42
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 169 570 2.0E-39
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 162 635 5.0E-38
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 162 635 5.0E-38
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 167 644 6.0E-34
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 162 570 7.0E-31
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 239 570 1.0E-30
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 168 555 2.0E-29
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 116 570 2.0E-29
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 167 640 1.0E-27
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 169 539 6.0E-27
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 167 569 9.0E-23
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 145 453 4.0E-22
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 167 576 9.0E-22
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 115 571 6.0E-19
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 115 571 6.0E-19
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 132 497 6.0E-19
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 132 497 7.0E-19
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 218 585 4.0E-17
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 218 585 4.0E-17
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 189 558 8.0E-15
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 134 477 4.0E-14
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 168 489 3.0E-13
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 167 445 5.0E-13
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 167 445 5.0E-13
sp|P44927|EMRB_HAEIN Multidrug export protein EmrB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=emrB PE=3 SV=1 218 583 8.0E-13
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 218 463 3.0E-12
sp|P9WG90|STP_MYCTO Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=stp PE=3 SV=1 169 458 1.0E-11
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 222 484 1.0E-11
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 214 463 4.0E-11
sp|P9WG91|STP_MYCTU Multidrug resistance protein Stp OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=stp PE=1 SV=1 169 458 7.0E-11
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 162 467 8.0E-11
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 168 308 2.0E-10
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 168 466 3.0E-10
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 162 457 5.0E-10
sp|B5XZP2|MDTL_KLEP3 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae (strain 342) GN=mdtL PE=3 SV=1 224 362 1.0E-09
sp|C6DBD0|MDTD_PECCP Putative multidrug resistance protein MdtD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdtD PE=3 SV=1 218 463 2.0E-09
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 218 463 2.0E-09
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 218 343 2.0E-09
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 218 463 2.0E-09
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 218 463 3.0E-09
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 218 463 3.0E-09
sp|B5BP47|YP53_SCHPO Uncharacterized transporter C460.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.03 PE=3 SV=1 101 326 4.0E-09
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 218 463 4.0E-09
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 218 343 4.0E-09
sp|O31563|YFIU_BACSU Uncharacterized MFS-type transporter YfiU OS=Bacillus subtilis (strain 168) GN=yfiU PE=3 SV=1 206 577 5.0E-09
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 218 343 5.0E-09
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 218 343 5.0E-09
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 218 343 5.0E-09
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 218 343 5.0E-09
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 218 343 5.0E-09
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 218 343 5.0E-09
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 218 343 6.0E-09
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 218 316 2.0E-08
sp|A6TG19|MDTL_KLEP7 Multidrug resistance protein MdtL OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtL PE=3 SV=1 224 362 2.0E-08
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 168 465 2.0E-08
sp|Q668C4|MDTD_YERPS Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtD PE=3 SV=1 168 316 8.0E-08
sp|B1JSD2|MDTD_YERPY Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtD PE=3 SV=1 168 316 9.0E-08
sp|A4TMR4|MDTD_YERPP Putative multidrug resistance protein MdtD OS=Yersinia pestis (strain Pestoides F) GN=mdtD PE=3 SV=1 168 316 9.0E-08
sp|Q1CK62|MDTD_YERPN Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtD PE=3 SV=1 168 316 9.0E-08
sp|A9QZU7|MDTD_YERPG Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtD PE=3 SV=1 168 316 9.0E-08
sp|Q7CJL1|MDTD_YERPE Putative multidrug resistance protein MdtD OS=Yersinia pestis GN=mdtD PE=3 SV=1 168 316 9.0E-08
sp|B2K9M2|MDTD_YERPB Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtD PE=3 SV=1 168 316 9.0E-08
sp|Q1C5L8|MDTD_YERPA Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtD PE=3 SV=1 168 316 9.0E-08
sp|A7FG15|MDTD_YERP3 Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtD PE=3 SV=1 168 316 9.0E-08
sp|P46104|LMRA_STRLN Lincomycin resistance protein OS=Streptomyces lincolnensis GN=lmrA PE=3 SV=1 168 483 9.0E-08
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 168 322 1.0E-07
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 168 322 1.0E-07
sp|A1JKW8|MDTD_YERE8 Putative multidrug resistance protein MdtD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtD PE=3 SV=2 218 335 1.0E-07
sp|Q870L3|MIRC_EMENI Siderophore iron transporter mirC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirC PE=3 SV=1 289 557 4.0E-07
sp|A8ACM0|MDTL_CITK8 Multidrug resistance protein MdtL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtL PE=3 SV=1 224 344 5.0E-07
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 186 457 7.0E-07
sp|P52600|EMRY_ECOLI Probable multidrug resistance protein EmrY OS=Escherichia coli (strain K12) GN=emrY PE=2 SV=1 218 607 7.0E-07
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 167 386 7.0E-07
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 186 457 7.0E-07
sp|P0A0J9|QACA_STAAU Antiseptic resistance protein OS=Staphylococcus aureus GN=qacA PE=1 SV=1 167 508 8.0E-07
sp|P0A0J8|QACA_STAAM Antiseptic resistance protein OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=qacA PE=3 SV=1 167 508 8.0E-07
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 192 460 8.0E-07
sp|Q08902|YO378_YEAST Drug resistance protein YOR378W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR378W PE=1 SV=1 186 492 1.0E-06
sp|A9MJT5|MDTL_SALAR Multidrug resistance protein MdtL OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mdtL PE=3 SV=1 224 332 1.0E-06
sp|B5BIM0|MDTL_SALPK Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtL PE=3 SV=1 224 344 2.0E-06
sp|Q5PKV6|MDTL_SALPA Multidrug resistance protein MdtL OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtL PE=3 SV=1 224 344 2.0E-06
sp|B4TAV4|MDTL_SALHS Multidrug resistance protein MdtL OS=Salmonella heidelberg (strain SL476) GN=mdtL PE=3 SV=1 223 337 2.0E-06
sp|B4TN12|MDTL_SALSV Multidrug resistance protein MdtL OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtL PE=3 SV=1 223 344 2.0E-06
sp|Q8Z2N9|MDTL_SALTI Multidrug resistance protein MdtL OS=Salmonella typhi GN=mdtL PE=3 SV=1 224 332 2.0E-06
sp|A9MX86|MDTL_SALPB Multidrug resistance protein MdtL OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtL PE=3 SV=1 223 344 2.0E-06
sp|B4SYB3|MDTL_SALNS Multidrug resistance protein MdtL OS=Salmonella newport (strain SL254) GN=mdtL PE=3 SV=1 223 344 2.0E-06
sp|B5EYX7|MDTL_SALA4 Multidrug resistance protein MdtL OS=Salmonella agona (strain SL483) GN=mdtL PE=3 SV=1 223 344 2.0E-06
sp|P94574|YWOD_BACSU Uncharacterized MFS-type transporter YwoD OS=Bacillus subtilis (strain 168) GN=ywoD PE=3 SV=1 168 441 3.0E-06
sp|Q04733|CMCT_AMYLA Cephamycin export protein CmcT OS=Amycolatopsis lactamdurans GN=cmcT PE=3 SV=1 168 464 4.0E-06
sp|Q8ZKY1|MDTL_SALTY Multidrug resistance protein MdtL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtL PE=3 SV=1 223 344 5.0E-06
sp|P9WJX3|Y1634_MYCTU Probable multidrug-efflux transporter Rv1634 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1634 PE=1 SV=1 174 328 7.0E-06
sp|P9WJX2|Y1634_MYCTO Probable multidrug-efflux transporter MT1670 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1670 PE=3 SV=1 174 328 7.0E-06
sp|B5QUQ6|MDTL_SALEP Multidrug resistance protein MdtL OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtL PE=3 SV=1 224 344 8.0E-06
sp|B5FN15|MDTL_SALDC Multidrug resistance protein MdtL OS=Salmonella dublin (strain CT_02021853) GN=mdtL PE=3 SV=1 224 344 8.0E-06
sp|C0Q2L5|MDTL_SALPC Multidrug resistance protein MdtL OS=Salmonella paratyphi C (strain RKS4594) GN=mdtL PE=3 SV=1 224 344 8.0E-06
sp|Q57HZ5|MDTL_SALCH Multidrug resistance protein MdtL OS=Salmonella choleraesuis (strain SC-B67) GN=mdtL PE=3 SV=1 224 344 8.0E-06
sp|Q668K2|NANT_YERPS Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nanT PE=3 SV=1 215 341 9.0E-06
sp|A9QZJ2|NANT_YERPG Putative sialic acid transporter OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nanT PE=3 SV=1 215 341 9.0E-06
sp|B2K942|NANT_YERPB Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nanT PE=3 SV=1 215 341 9.0E-06
sp|A7FG99|NANT_YERP3 Putative sialic acid transporter OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nanT PE=3 SV=1 215 341 9.0E-06
sp|A4TMJ0|NANT_YERPP Putative sialic acid transporter OS=Yersinia pestis (strain Pestoides F) GN=nanT PE=3 SV=1 215 341 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 187 205 18
2 220 242 22
3 247 266 19
4 276 298 22
5 305 327 22
6 342 364 22
7 376 398 22
8 418 440 22
9 453 475 22
10 480 502 22
11 509 531 22
12 613 635 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4409
MPRPVRNYPREGERERVSRPVSNTWRLSTIGSDELSVFSPLEVTHITALDFVFPSQRMSWRHSFASNSDLPPRFP
PRASTVKPAKGQQLGSLSTTSFVDSSITPTDTSARELPPSDDQHSILSWHLSDVARTPATEPEPEYPSGFRHGKS
SSPSFPWWHNSIADPPQTIVATAVPAITDEFHGLQDVAWYGAIFFMTAGGFQSTWGKTYKSFPLKMGFLTAIFIF
EVGSLICGVASSSSVFIIGRAIAGVGAAGVGSGSYTLVAFIAEPKKRAAYTGLLGAIFGIGSVLGPLLGGVFSSR
STWRWCFYINLPIGLLPLLTIVFFFRPPNTAKPQKAPLKEKLLQMDPLGTCLLMGAIITYLTAVNYGGQIHPWSS
SVVIALFVAAFLLSLAFMLCEYWQGDRAIVIPRLFCTRRIGLSAVYSILQSGAFFSMIYYLPLYFQAIRGSDAVI
SGVQNLPFILAAMLGALGAGIFISSTGMSTLVMVAGAAIGTLGCGLCYTFGMNTSTGTWIGFQIIAGVSLGGALQ
IPVIVGQVSVQPEDLSSATSMMLCFQTLGGAIWTSAAQSAFVNRMMVVLPSLAPGVDPMRVVATGAGQLRQVFQA
RQLLGVLAAYLDGIRTAFILSCAAVGAACVLGLFLPWKRLDVVAVRENPGGGG
Coding >Ophio5|4409
ATGCCCCGGCCTGTCCGGAATTATCCCCGGGAGGGGGAGCGGGAGCGGGTCTCGCGACCCGTGAGCAACACATGG
CGCCTCTCCACCATCGGCTCCGATGAGCTGTCCGTCTTCAGTCCCCTCGAGGTGACGCACATCACCGCCCTCGAC
TTCGTCTTTCCCTCTCAGCGAATGAGTTGGCGACATTCCTTCGCCAGCAATTCAGACCTTCCCCCGCGCTTCCCT
CCGAGGGCATCGACTGTCAAGCCCGCCAAGGGCCAGCAGCTCGGCTCCCTGTCTACGACGTCGTTTGTTGATTCC
TCCATCACGCCCACTGATACGTCGGCCCGCGAATTGCCCCCATCCGATGACCAACATTCCATCCTCTCTTGGCAT
CTGAGTGATGTCGCCCGTACGCCGGCGACAGAGCCCGAGCCCGAGTACCCCTCCGGTTTCAGACATGGCAAGTCG
TCGTCTCCGTCTTTTCCATGGTGGCACAACTCTATCGCTGACCCACCGCAGACCATTGTTGCCACGGCCGTTCCC
GCCATCACAGATGAGTTCCACGGGCTCCAGGATGTGGCCTGGTACGGGGCAATCTTCTTCATGACCGCCGGCGGC
TTTCAGTCCACCTGGGGGAAGACGTACAAGTCTTTCCCCCTCAAAATGGGCTTCCTGACCGCCATCTTCATCTTC
GAAGTCGGCAGTTTGATCTGCGGCGTTGCCTCTAGCTCGTCCGTCTTCATCATAGGCCGTGCCATAGCAGGTGTC
GGTGCCGCCGGCGTCGGCTCCGGCTCCTATACCTTGGTTGCCTTCATCGCCGAGCCTAAGAAGCGAGCGGCCTAC
ACCGGACTTCTTGGGGCCATCTTCGGCATCGGGAGCGTTCTCGGCCCCCTTCTGGGCGGCGTCTTCTCCAGTAGA
AGCACTTGGAGATGGTGCTTTTACATCAATCTTCCAATTGGCCTTCTGCCCCTTCTCACCATCGTCTTCTTCTTC
CGCCCTCCCAATACGGCAAAGCCCCAAAAGGCACCCCTGAAAGAGAAGCTGCTCCAAATGGACCCTTTGGGCACA
TGCCTCCTGATGGGGGCCATCATCACCTACCTCACGGCCGTCAACTACGGCGGCCAGATTCACCCCTGGTCATCC
TCGGTCGTCATAGCTCTCTTCGTCGCCGCCTTTCTTCTCTCCCTTGCCTTTATGCTGTGTGAGTATTGGCAGGGA
GACAGAGCCATCGTCATCCCTCGCCTGTTCTGTACAAGGCGCATTGGCCTGTCAGCCGTCTACTCCATTCTGCAA
TCCGGCGCCTTCTTCTCCATGATATACTACCTTCCGCTCTATTTCCAGGCCATCAGGGGAAGTGACGCCGTCATC
TCTGGTGTGCAGAACTTGCCCTTCATCCTTGCCGCTATGCTCGGCGCCCTCGGTGCCGGCATCTTCATCTCGAGC
ACCGGCATGTCGACCCTAGTCATGGTGGCTGGGGCCGCGATAGGAACTCTTGGATGTGGCCTCTGCTACACGTTT
GGCATGAATACCTCGACCGGCACTTGGATCGGCTTTCAAATCATTGCCGGCGTGAGCCTTGGCGGCGCACTCCAG
ATCCCCGTCATCGTGGGCCAAGTCAGTGTCCAGCCGGAGGATCTGTCGTCTGCCACGTCCATGATGCTCTGCTTC
CAGACGCTTGGCGGCGCAATTTGGACCTCGGCGGCCCAATCGGCCTTTGTCAATCGAATGATGGTCGTCCTGCCC
TCCCTGGCGCCCGGCGTTGACCCAATGAGAGTTGTGGCCACCGGCGCTGGACAGCTACGCCAGGTTTTCCAGGCA
AGACAGCTTCTAGGCGTCTTGGCCGCCTATCTCGACGGCATCAGAACTGCCTTCATCCTGTCTTGTGCCGCCGTG
GGCGCCGCTTGTGTTTTGGGACTATTCCTGCCCTGGAAGAGGCTTGACGTGGTTGCCGTGAGAGAAAACCCTGGG
GGGGGTGGT
Transcript >Ophio5|4409
ATGCCCCGGCCTGTCCGGAATTATCCCCGGGAGGGGGAGCGGGAGCGGGTCTCGCGACCCGTGAGCAACACATGG
CGCCTCTCCACCATCGGCTCCGATGAGCTGTCCGTCTTCAGTCCCCTCGAGGTGACGCACATCACCGCCCTCGAC
TTCGTCTTTCCCTCTCAGCGAATGAGTTGGCGACATTCCTTCGCCAGCAATTCAGACCTTCCCCCGCGCTTCCCT
CCGAGGGCATCGACTGTCAAGCCCGCCAAGGGCCAGCAGCTCGGCTCCCTGTCTACGACGTCGTTTGTTGATTCC
TCCATCACGCCCACTGATACGTCGGCCCGCGAATTGCCCCCATCCGATGACCAACATTCCATCCTCTCTTGGCAT
CTGAGTGATGTCGCCCGTACGCCGGCGACAGAGCCCGAGCCCGAGTACCCCTCCGGTTTCAGACATGGCAAGTCG
TCGTCTCCGTCTTTTCCATGGTGGCACAACTCTATCGCTGACCCACCGCAGACCATTGTTGCCACGGCCGTTCCC
GCCATCACAGATGAGTTCCACGGGCTCCAGGATGTGGCCTGGTACGGGGCAATCTTCTTCATGACCGCCGGCGGC
TTTCAGTCCACCTGGGGGAAGACGTACAAGTCTTTCCCCCTCAAAATGGGCTTCCTGACCGCCATCTTCATCTTC
GAAGTCGGCAGTTTGATCTGCGGCGTTGCCTCTAGCTCGTCCGTCTTCATCATAGGCCGTGCCATAGCAGGTGTC
GGTGCCGCCGGCGTCGGCTCCGGCTCCTATACCTTGGTTGCCTTCATCGCCGAGCCTAAGAAGCGAGCGGCCTAC
ACCGGACTTCTTGGGGCCATCTTCGGCATCGGGAGCGTTCTCGGCCCCCTTCTGGGCGGCGTCTTCTCCAGTAGA
AGCACTTGGAGATGGTGCTTTTACATCAATCTTCCAATTGGCCTTCTGCCCCTTCTCACCATCGTCTTCTTCTTC
CGCCCTCCCAATACGGCAAAGCCCCAAAAGGCACCCCTGAAAGAGAAGCTGCTCCAAATGGACCCTTTGGGCACA
TGCCTCCTGATGGGGGCCATCATCACCTACCTCACGGCCGTCAACTACGGCGGCCAGATTCACCCCTGGTCATCC
TCGGTCGTCATAGCTCTCTTCGTCGCCGCCTTTCTTCTCTCCCTTGCCTTTATGCTGTGTGAGTATTGGCAGGGA
GACAGAGCCATCGTCATCCCTCGCCTGTTCTGTACAAGGCGCATTGGCCTGTCAGCCGTCTACTCCATTCTGCAA
TCCGGCGCCTTCTTCTCCATGATATACTACCTTCCGCTCTATTTCCAGGCCATCAGGGGAAGTGACGCCGTCATC
TCTGGTGTGCAGAACTTGCCCTTCATCCTTGCCGCTATGCTCGGCGCCCTCGGTGCCGGCATCTTCATCTCGAGC
ACCGGCATGTCGACCCTAGTCATGGTGGCTGGGGCCGCGATAGGAACTCTTGGATGTGGCCTCTGCTACACGTTT
GGCATGAATACCTCGACCGGCACTTGGATCGGCTTTCAAATCATTGCCGGCGTGAGCCTTGGCGGCGCACTCCAG
ATCCCCGTCATCGTGGGCCAAGTCAGTGTCCAGCCGGAGGATCTGTCGTCTGCCACGTCCATGATGCTCTGCTTC
CAGACGCTTGGCGGCGCAATTTGGACCTCGGCGGCCCAATCGGCCTTTGTCAATCGAATGATGGTCGTCCTGCCC
TCCCTGGCGCCCGGCGTTGACCCAATGAGAGTTGTGGCCACCGGCGCTGGACAGCTACGCCAGGTTTTCCAGGCA
AGACAGCTTCTAGGCGTCTTGGCCGCCTATCTCGACGGCATCAGAACTGCCTTCATCCTGTCTTGTGCCGCCGTG
GGCGCCGCTTGTGTTTTGGGACTATTCCTGCCCTGGAAGAGGCTTGACGTGGTTGCCGTGAGAGAAAACCCTGGG
GGGGGTGGTTAA
Gene >Ophio5|4409
ATGCCCCGGCCTGTCCGGAATTATCCCCGGGAGGGGGAGCGGGAGCGGGTCTCGCGACCCGTGAGCAACACATGG
CGCCTCTCCACCATCGGCTCCGATGAGCTGTCCGTCTTCAGTCCCCTCGAGGTGACGCACATCACCGCCCTCGAC
TTCGTCTTTCCCTCTCAGCGAATGAGTTGGCGACATTCCTTCGCCAGCAATTCAGACCTTCCCCCGCGCTTCCCT
CCGAGGGCATCGACTGTCAAGCCCGCCAAGGGCCAGCAGCTCGGCTCCCTGTCTACGACGTCGTTTGTTGATTCC
TCCATCACGCCCACTGATACGTCGGCCCGCGAATTGCCCCCATCCGATGACCAACATTCCATCCTCTCTTGGCAT
CTGAGTGATGTCGCCCGTACGCCGGCGACAGAGCCCGAGCCCGAGTACCCCTCCGGTTTCAGGTTATGGATAATG
ATAGCCGCCCTCGTCTCCAGCATCTTTCTCATTGCATTAGACATGGCAAGTCGTCGTCTCCGTCTTTTCCATGGT
GGCACAACTCTATCGCTGACCCACCGCAGACCATTGTTGCCACGGCCGTTCCCGCCATCACAGATGAGTTCCACG
GGCTCCAGGATGTGGCCTGGTACGGGGCAATCTTCTTCATGACCGCCGGCGGCTTTCAGTCCACCTGGGGGAAGA
CGTACAAGTCTTTCCCCCTCAAAATGGGCTTCCTGACCGCCATCTTCATCTTCGAAGTCGGCAGTTTGATCTGCG
GCGTTGCCTCTAGCTCGTCCGTCTTCATCATAGGCCGTGCCATAGCAGGTGTCGGTGCCGCCGGCGTCGGCTCCG
GCTCCTATACCTTGGTTGCCTTCATCGCCGAGCCTAAGAAGCGAGCGGCCTACACCGGACTTCTTGGGGCCATCT
TCGGCATCGGGAGCGTTCTCGGCCCCCTTCTGGGCGGCGTCTTCTCCAGTAGAAGCACTTGGAGATGGTCAGAAT
CGCCGCCGCCGCCCGACGGACCTAAGCCAAAGAAAGCATGCTAACCCTACCAGCAGGTGCTTTTACATCAATCTT
CCAATTGGCCTTCTGCCCCTTCTCACCATCGTCTTCTTCTTCCGCCCTCCCAATACGGCAAAGCCCCAAAAGGCA
CCCCTGAAAGAGAAGCTGCTCCAAATGGACCCTTTGGGCACATGCCTCCTGATGGGGGCCATCATCACCTACCTC
ACGGCCGTCAACTACGGCGGCCAGATTCACCCCTGGTCATCCTCGGTCGTCATAGCTCTCTTCGTCGCCGCCTTT
CTTCTCTCCCTTGCCTTTATGCTGTGTGAGTATTGGCAGGGAGACAGAGCCATCGTCATCCCTCGCCTGTTCTGT
ACAAGGCGCATTGGCCTGTCAGCCGTCTACTCCATTCTGCAATCCGGCGCCTTCTTCTCCATGATATACTACCTT
CCGCTCTATTTCCAGGCCATCAGGGGAAGTGACGCCGTCATCTCTGGTGTGCAGAACTTGCCCTTCATCCTTGCC
GCTATGCTCGGCGCCCTCGGTGCCGGCATCTTCATCTCGAGCACCGGCATGTCGACCCTAGTCATGGTGGCTGGG
GCCGCGATAGGAACTCTTGGATGTGGCCTCTGCTACACGTTTGGCATGAATACCTCGACCGGCACTTGGATCGGC
TTTCAAATCATTGCCGGCGTGAGCCTTGGCGGCGCACTCCAGATCCCCGTCATCGTGGGCCAAGTCAGTGTCCAG
CCGGAGGATCTGTCGTCTGCCACGTCCATGATGCTCTGCTTCCAGACGCTTGGCGGCGCAATTTGGACCTCGGCG
GCCCAATCGGCCTTTGTCAATCGAATGATGGTCGTCCTGCCCTCCCTGGCGCCCGGCGTTGACCCAATGAGAGTT
GTGGCCACCGGCGCTGGACAGCTACGCCAGGTTTTCCAGGCAAGACAGCTTCTAGGCGTCTTGGCCGCCTATCTC
GACGGCATCAGAACTGCCTTCATCCTGTCTTGTGCCGCCGTGGGCGCCGCTTGTGTTTTGGGACTATTCCTGCCC
TGGAAGAGGCTTGACGTGGTTGCCGTGAGAGAAAACCCTGGGGGGGGTGGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail