Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|44
Gene name
Locationscaffold_1:100758..101574
Strand-
Gene length (bp)816
Transcript length (bp)759
Coding sequence length (bp)756
Protein length (aa) 252

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08566 Pam17 Mitochondrial import protein Pam17 1.4E-56 98 248

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4ICM9|PAM17_GIBZE Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAM17 PE=3 SV=1 1 252 9.0E-78
sp|Q7SEE1|PAM17_NEUCR Presequence translocated-associated motor subunit pam17, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pam17 PE=3 SV=1 100 248 2.0E-60
sp|Q4WKN3|PAM17_ASPFU Presequence translocated-associated motor subunit pam17, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pam17 PE=3 SV=1 101 247 2.0E-47
sp|C8VTR5|PAM17_EMENI Presequence translocated-associated motor subunit pam17, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pam17 PE=3 SV=1 103 247 1.0E-45
sp|Q4P983|PAM17_USTMA Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAM17 PE=3 SV=1 103 246 8.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4ICM9|PAM17_GIBZE Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PAM17 PE=3 SV=1 1 252 9.0E-78
sp|Q7SEE1|PAM17_NEUCR Presequence translocated-associated motor subunit pam17, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pam17 PE=3 SV=1 100 248 2.0E-60
sp|Q4WKN3|PAM17_ASPFU Presequence translocated-associated motor subunit pam17, mitochondrial OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pam17 PE=3 SV=1 101 247 2.0E-47
sp|C8VTR5|PAM17_EMENI Presequence translocated-associated motor subunit pam17, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pam17 PE=3 SV=1 103 247 1.0E-45
sp|Q4P983|PAM17_USTMA Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAM17 PE=3 SV=1 103 246 8.0E-35
sp|P36147|PAM17_YEAST Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAM17 PE=1 SV=1 76 246 7.0E-29
sp|O94539|PAM17_SCHPO Presequence translocated-associated motor subunit pam17, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pam17 PE=3 SV=2 102 243 9.0E-29
sp|Q6FJJ0|PAM17_CANGA Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAM17 PE=3 SV=1 95 246 2.0E-28
sp|Q6BKZ1|PAM17_DEBHA Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAM17 PE=3 SV=2 92 246 4.0E-25
sp|Q6CXR8|PAM17_KLULA Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAM17 PE=3 SV=1 102 246 4.0E-25
sp|P0CP48|PAM17_CRYNJ Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAM17 PE=3 SV=1 83 246 6.0E-24
sp|P0CP49|PAM17_CRYNB Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAM17 PE=3 SV=1 83 246 6.0E-24
sp|Q5AEM8|PAM17_CANAL Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAM17 PE=3 SV=2 100 246 4.0E-23
sp|Q759E9|PAM17_ASHGO Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAM17 PE=3 SV=1 102 252 3.0E-20
sp|Q6CFW6|PAM17_YARLI Presequence translocated-associated motor subunit PAM17, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAM17 PE=3 SV=1 156 247 3.0E-18
[Show less]

GO

GO Term Description Terminal node
GO:0001405 PAM complex, Tim23 associated import motor Yes
GO:0098800 inner mitochondrial membrane protein complex No
GO:0098796 membrane protein complex No
GO:0032991 protein-containing complex No
GO:0005575 cellular_component No
GO:0098798 mitochondrial protein-containing complex No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

Domain # Start End Length
1 120 142 22
2 162 184 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|44
MASALRTFVSRCPPQQPPSSPLYCFARSCRRPPHGRLTLPLRPVRCLASAAPRPGASSAAASQSNHVASNVPVTD
APPPSSSASTSSPPPSSIPFSPLPKPSLDWNSFFRLRLRRRRIQVAFSLTGFLVCGFGGAYVLSTGVAEPLVAQV
PLDPVFTLGLLGAACAGMGWLAGPSIGNQVFYLLNWPFKSQMIRKESEFFTRIKRNRVDPSNSSAGNPVPDFYGE
RIQSVTGYRQWLKDQRAFNRKKTANFV
Coding >Ophio5|44
ATGGCATCGGCGCTCAGGACCTTTGTCTCGCGCTGCCCGCCGCAGCAGCCCCCGTCTTCGCCTCTCTACTGCTTC
GCCCGCTCGTGTCGCCGCCCTCCTCATGGCCGTCTGACTCTGCCTTTGCGCCCGGTTCGGTGCTTGGCCAGCGCA
GCACCGCGGCCGGGGGCTTCATCCGCGGCCGCTTCGCAATCAAATCACGTGGCTTCCAACGTGCCCGTTACCGAC
GCGCCCCCTCCGAGCTCGTCCGCTTCGACGTCATCTCCGCCGCCCTCGTCCATCCCCTTCAGCCCTCTTCCCAAG
CCGTCGCTCGACTGGAATTCCTTCTTCCGGCTGCGTCTCCGCCGTCGTCGCATTCAGGTCGCCTTCTCCTTAACC
GGCTTCCTTGTCTGCGGCTTCGGAGGCGCCTATGTTCTGTCCACCGGCGTGGCTGAGCCGCTCGTTGCACAGGTC
CCGCTCGATCCCGTCTTCACCCTCGGCCTCCTCGGCGCCGCCTGTGCCGGCATGGGCTGGCTGGCGGGGCCGAGC
ATCGGCAATCAGGTCTTCTATCTCCTCAACTGGCCCTTCAAGTCCCAGATGATCCGCAAGGAGAGCGAGTTCTTC
ACCAGGATCAAGAGGAACAGGGTGGATCCATCAAACTCGAGCGCCGGAAACCCAGTCCCCGACTTCTACGGCGAG
AGAATCCAGAGCGTTACGGGCTACAGGCAGTGGCTCAAGGATCAGCGGGCGTTTAACAGAAAGAAGACGGCAAAC
TTTGTC
Transcript >Ophio5|44
ATGGCATCGGCGCTCAGGACCTTTGTCTCGCGCTGCCCGCCGCAGCAGCCCCCGTCTTCGCCTCTCTACTGCTTC
GCCCGCTCGTGTCGCCGCCCTCCTCATGGCCGTCTGACTCTGCCTTTGCGCCCGGTTCGGTGCTTGGCCAGCGCA
GCACCGCGGCCGGGGGCTTCATCCGCGGCCGCTTCGCAATCAAATCACGTGGCTTCCAACGTGCCCGTTACCGAC
GCGCCCCCTCCGAGCTCGTCCGCTTCGACGTCATCTCCGCCGCCCTCGTCCATCCCCTTCAGCCCTCTTCCCAAG
CCGTCGCTCGACTGGAATTCCTTCTTCCGGCTGCGTCTCCGCCGTCGTCGCATTCAGGTCGCCTTCTCCTTAACC
GGCTTCCTTGTCTGCGGCTTCGGAGGCGCCTATGTTCTGTCCACCGGCGTGGCTGAGCCGCTCGTTGCACAGGTC
CCGCTCGATCCCGTCTTCACCCTCGGCCTCCTCGGCGCCGCCTGTGCCGGCATGGGCTGGCTGGCGGGGCCGAGC
ATCGGCAATCAGGTCTTCTATCTCCTCAACTGGCCCTTCAAGTCCCAGATGATCCGCAAGGAGAGCGAGTTCTTC
ACCAGGATCAAGAGGAACAGGGTGGATCCATCAAACTCGAGCGCCGGAAACCCAGTCCCCGACTTCTACGGCGAG
AGAATCCAGAGCGTTACGGGCTACAGGCAGTGGCTCAAGGATCAGCGGGCGTTTAACAGAAAGAAGACGGCAAAC
TTTGTCTAA
Gene >Ophio5|44
ATGGCATCGGCGCTCAGGACCTTTGTCTCGCGCTGCCCGCCGCAGCAGCCCCCGTCTTCGCCTCTCTACTGCTTC
GCCCGCTCGTGTCGCCGCCCTCCTCATGGCCGTCTGACTCTGCCTTTGCGCCCGGTTCGGTGCTTGGCCAGCGCA
GCACCGCGGCCGGGGGCTTCATCCGCGGCCGCTTCGCAATCAAATCACGTGGCTTCCAACGTGCCCGTTACCGAC
GCGCCCCCTCCGAGCTCGTCCGCTTCGACGTCATCTCCGCCGCCCTCGTCCATCCCCTTCAGCCCTCTTCCCAAG
CCGTCGCTCGACTGGAATTCCTTCTTCCGGCTGCGTCTCCGCCGTCGTCGCATTCAGGTCGCCTTCTCCTTAACC
GGCTTCCTTGTCTGCGGCTTCGGAGGCGCCTATGTTCTGTCCACCGGCGTGGCTGAGCCGCTCGTTGCACAGGTC
CCGCTCGATCCCGTCTTCACCCTCGGCCTCCTCGGCGCCGCCTGTGCCGGCATGGGCTGGCTGGCGGGGCCGAGC
ATCGGCAATCAGGTCTTCTATCTCCTCAACTGGCCCTTCAAGTCCCAGATGATCCGCAAGGAGAGCGAGTTCTTC
ACCAGGATCAAGAGGAACAGGGTGGATCCATCAAACTCGAGCGCCGGAAACCCAGGTGCGCTTGGCCTATCCCTC
ATATCCTTCCCATGCGGCGCTTGCTGACCTGTCTCAGTCCCCGACTTCTACGGCGAGAGAATCCAGAGCGTTACG
GGCTACAGGCAGTGGCTCAAGGATCAGCGGGCGTTTAACAGAAAGAAGACGGCAAACTTTGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail