Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4389
Gene name
Locationscaffold_349:362..6257
Strand-
Gene length (bp)5895
Transcript length (bp)5622
Coding sequence length (bp)5619
Protein length (aa) 1873

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04118 Dopey_N Dopey, N-terminal 4.3E-117 37 363

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7B3|DOP1_EMENI Protein dopey OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dop1 PE=1 SV=1 36 1869 0.0E+00
sp|Q03921|DOP1_YEAST Protein dopey OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOP1 PE=1 SV=1 37 925 6.0E-74
sp|Q9C0Z4|DOP1_SCHPO Protein dopey OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB21F2.02 PE=1 SV=1 36 565 1.0E-53
sp|Q8BL99|DOP1_MOUSE Protein dopey-1 OS=Mus musculus GN=Dopey1 PE=1 SV=2 29 481 1.0E-51
sp|Q5JWR5|DOP1_HUMAN Protein dopey-1 OS=Homo sapiens GN=DOPEY1 PE=2 SV=1 29 481 1.0E-51
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7B3|DOP1_EMENI Protein dopey OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dop1 PE=1 SV=1 36 1869 0.0E+00
sp|Q03921|DOP1_YEAST Protein dopey OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOP1 PE=1 SV=1 37 925 6.0E-74
sp|Q9C0Z4|DOP1_SCHPO Protein dopey OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB21F2.02 PE=1 SV=1 36 565 1.0E-53
sp|Q8BL99|DOP1_MOUSE Protein dopey-1 OS=Mus musculus GN=Dopey1 PE=1 SV=2 29 481 1.0E-51
sp|Q5JWR5|DOP1_HUMAN Protein dopey-1 OS=Homo sapiens GN=DOPEY1 PE=2 SV=1 29 481 1.0E-51
sp|Q642P2|DOP2_XENLA Protein dopey-2 OS=Xenopus laevis GN=dopey2 PE=2 SV=1 37 456 3.0E-49
sp|Q3UHQ6|DOP2_MOUSE Protein dopey-2 OS=Mus musculus GN=Dopey2 PE=1 SV=3 35 456 2.0E-47
sp|Q9Y3R5|DOP2_HUMAN Protein dopey-2 OS=Homo sapiens GN=DOPEY2 PE=1 SV=5 35 456 6.0E-46
sp|Q9C0Z4|DOP1_SCHPO Protein dopey OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB21F2.02 PE=1 SV=1 1123 1868 2.0E-44
sp|Q292H2|DOP1_DROPS Protein dopey-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA13490 PE=3 SV=1 35 511 2.0E-43
sp|A1ZBE8|DOP1_DROME Protein dopey-1 homolog OS=Drosophila melanogaster GN=CG15099 PE=1 SV=1 35 507 3.0E-43
sp|Q03921|DOP1_YEAST Protein dopey OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DOP1 PE=1 SV=1 1088 1863 1.0E-42
sp|Q9XW10|PAD1_CAEEL Protein pad-1 OS=Caenorhabditis elegans GN=pad-1 PE=2 SV=2 36 457 4.0E-36
sp|Q5WNI9|PAD1_CAEBR Protein pad-1 OS=Caenorhabditis briggsae GN=pad-1 PE=3 SV=1 36 463 1.0E-33
sp|A1ZBE8|DOP1_DROME Protein dopey-1 homolog OS=Drosophila melanogaster GN=CG15099 PE=1 SV=1 1348 1770 3.0E-15
sp|Q292H2|DOP1_DROPS Protein dopey-1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA13490 PE=3 SV=1 1348 1752 6.0E-14
sp|Q5JWR5|DOP1_HUMAN Protein dopey-1 OS=Homo sapiens GN=DOPEY1 PE=2 SV=1 1104 1752 1.0E-13
sp|Q9XW10|PAD1_CAEEL Protein pad-1 OS=Caenorhabditis elegans GN=pad-1 PE=2 SV=2 1455 1824 3.0E-11
sp|Q642P2|DOP2_XENLA Protein dopey-2 OS=Xenopus laevis GN=dopey2 PE=2 SV=1 1104 1747 2.0E-10
sp|O97239|DOP1_PLAF7 Protein dopey homolog PFC0245c OS=Plasmodium falciparum (isolate 3D7) GN=PFC0245c PE=2 SV=1 41 319 6.0E-10
sp|Q3UHQ6|DOP2_MOUSE Protein dopey-2 OS=Mus musculus GN=Dopey2 PE=1 SV=3 1023 1749 3.0E-09
sp|Q9Y3R5|DOP2_HUMAN Protein dopey-2 OS=Homo sapiens GN=DOPEY2 PE=1 SV=5 1084 1750 2.0E-07
sp|Q5WNI9|PAD1_CAEBR Protein pad-1 OS=Caenorhabditis briggsae GN=pad-1 PE=3 SV=1 1454 1774 4.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4389
MALEQASGVYSASPESSGRESPVPRGWRNQDELPIKDKAYRKYASAVEKVLSQFETALEEWADYISFLNRLLKSL
QARPASITTIPAKAIVAKRLSQCLNPALPSGVHQKALEVYSYVFSVIGKEGLSRHLSLYLPGLAPTLSFASLSVR
APFLDLLETHVLRADPRSLRPAIKSIILALLPGLEDETSEDFDRTLSLVTSFKKAIRPPESEQIDQHHSSGDSFF
WQCFFLASITGHSRRSGALAYLNHNLPVLAPVSSSSPPVATSQEDDADESCKTALVVTSPEPGLLVRCFASGLAD
DQLLIQRGFLDLLVSHLPLNSSVLQSRVKSADLKLLVEAAAGVVTRRDMSLNRRLWAWLLGPEPTGNEGESVGDP
TTPSREQQQPSLSPRTNYFEEFGLQPLTRALLDMIRGASSGTATERARPYRICLSLMDKWEIGGLVVPEVFLPVV
ESVRQYHSRAPAKADFAEVLRSASVFFDGIESGLIFSEMFRLLAQALGVESISMGERMDKISLVGFIVANFNVRE
EEMVTIHGPLTCLAALSMLEHLQARAAKSGLAGAEVVKLSEQALNVIVSLVELVPDRAFPAARPEAVTSSFASNA
DIVKRVRAFYLDHHGNLDSSPPPIEAIECGELLLQKAVKYTGDNDDDLGSNEDLGLRVRIYTLMLLKTPTSYKLD
VERSMSHLKAQLQQTCPLPFSHLSSVLHLATQLYSADRIDATQLSEMVGPLVYHAWSYLAASDPKYHVETVRCLW
QLQTALTPWNREIEAALCGILLDCQSRFAEAARTFGVLWSHTLQDTAGDRRGPRTPMQEYRPTLRLSGMEHYPVM
LTQPLFLVLDALLDERTQAYIVVKSWLNNTIGIDRLFLLFVTKLSEMSFLSFIASDGSKTGADPIMFSRDDDLDL
CLYYLRALRLVLRCTGDAPRSVLASRYLFFGGGQTQIRGSAEEGEMTLQDYFIRVCAECVTGEVVSGADQELVEQ
ISQLRRYALIILDEFLSSRHGLSIVPHQLDKILMDRLAKSIDTPDPYLQVLLLDVILDTLKLQETTQGGRPTTAT
SERMSSMTDRARAGRTSTSMSESSPAGPQMPPQLLKCLQAGLSCPSSHSVLDSWISFLGDCLPFFSHSIFQVLVP
LVETLCRQIGATLSNLRNTFQAGPQPSRSGAGGAPESALFYLLNGLERVLALAHDQLLTEETRARLLKGPEQTQS
LLGSMVSGVFQSESAQSRSATANDRLTVHLAFQDTMRTCYKIWSWGQGEEGRKQEPSSLASFNYTSLRMRNRARR
LLEHLFAAETLECLETVIGIWRSAAGSAEGGQVLNFLSALDACRPRHCVPALFNSIYSRTNPGALDPSRKSAMTI
SLQDLDLVVFLVEYARSLEDDAMDEIWADCMTFLRDLLGNPFPHRRTLPSLLEFAGILGEKVDKTNFGEQRRMRR
ELSDLFLRLLAALFTTRPMTFAEPNGPAAERSTGSNRRRTLSSGGGGGDGSDHVVRVLASIVPKLPQILLENDRV
VSAATTISTNVIGPALRSRAFPDTFSPDLIRLLLELSRLHNGQKAWKKDVGEAFNDGRFFGTRPEVVEADWLPLL
RQWAVADKERMGEIVGRISAPTTAGIVFGVGATSARLEADRRTQLNLRRMATLVLASADDGFVADLPVVLDKLVE
LLAATPTSSPSSTTRADVFQVVRALVLKTNPVHLAALWPVVNGEMHAAMSSVVDAPDDHSMASETYAPSAVVEAC
KLLDVLVCVAPDDFQLHEWLFVTDTIDAVYRPSAYRPVALVDELADELGGVGGGGGGGEAATTTTVSWGGQDDDV
DAGPRRPLLLPLAGGDVPERKDDLVATVLRPFFAQLTIFAFESTYAMGVLDREACIGGLLRDLFDERSMVRAM
Coding >Ophio5|4389
ATGGCGCTTGAACAGGCTTCCGGCGTCTACTCGGCGTCTCCCGAAAGCTCTGGACGCGAATCGCCAGTCCCCCGA
GGCTGGAGGAACCAAGACGAGCTTCCGATCAAGGACAAGGCGTATCGCAAGTATGCCTCGGCCGTCGAAAAAGTC
CTTTCACAGTTCGAGACGGCCTTGGAGGAGTGGGCCGACTACATCTCCTTTCTAAACAGGCTGCTCAAGTCCCTA
CAGGCCCGGCCCGCGTCCATCACTACGATACCGGCCAAGGCCATCGTCGCCAAGCGTCTGTCTCAGTGCCTCAAC
CCCGCCCTGCCGTCGGGCGTTCATCAAAAGGCCCTCGAGGTCTATAGCTACGTCTTTTCCGTTATTGGAAAAGAA
GGCTTGTCACGACATCTATCTCTCTACCTACCGGGTCTGGCACCGACACTCTCCTTCGCCTCGCTCTCCGTCCGA
GCGCCTTTCCTCGACCTCCTAGAGACGCATGTCCTTCGGGCCGATCCGCGCTCTCTCCGGCCGGCCATCAAGTCC
ATCATATTAGCGTTGCTTCCGGGCCTGGAAGATGAGACGAGCGAGGACTTCGATCGCACCCTGAGTCTCGTCACG
AGTTTCAAGAAAGCCATCAGGCCCCCGGAGAGCGAACAGATTGATCAACACCACTCCTCCGGAGATTCCTTCTTC
TGGCAATGCTTTTTCTTGGCTTCAATCACAGGCCACAGCCGTCGCTCCGGAGCGTTGGCATATTTGAACCATAAT
CTACCTGTTTTGGCCCCCGTTTCATCCAGCAGCCCTCCCGTTGCCACCTCTCAAGAAGATGATGCAGATGAGAGC
TGCAAGACGGCACTCGTTGTGACCTCCCCCGAGCCGGGACTTTTGGTACGGTGCTTTGCCAGCGGTTTGGCAGAT
GATCAGCTATTAATCCAGCGGGGCTTTCTCGATCTCTTGGTGTCCCATCTACCCCTGAATTCGAGCGTGCTGCAG
TCCCGCGTAAAGTCTGCCGACCTCAAGCTACTTGTCGAGGCCGCGGCCGGTGTGGTAACGCGGCGGGACATGAGT
TTGAACAGGCGGCTATGGGCATGGCTGCTTGGTCCGGAGCCAACCGGTAACGAAGGGGAGAGCGTCGGCGACCCG
ACGACGCCCTCGCGCGAGCAGCAGCAGCCGTCCCTATCGCCCAGGACCAACTATTTTGAAGAATTCGGGCTGCAG
CCGCTGACGAGAGCCTTGCTGGATATGATTAGGGGAGCTTCCAGCGGCACCGCTACCGAACGAGCTCGGCCGTAC
CGGATATGTCTCTCTCTGATGGACAAGTGGGAGATTGGGGGGCTGGTTGTTCCCGAAGTCTTTTTGCCTGTCGTG
GAGAGCGTCCGGCAGTACCACAGCCGGGCGCCGGCCAAGGCTGACTTCGCCGAGGTTTTGCGCAGTGCCAGCGTA
TTCTTCGACGGCATCGAGAGCGGCCTCATCTTCAGCGAGATGTTCCGGCTACTGGCTCAGGCTCTCGGCGTCGAA
AGTATCAGCATGGGCGAGCGAATGGACAAAATCTCTCTCGTCGGTTTCATCGTCGCAAACTTCAACGTCCGCGAA
GAGGAGATGGTCACAATCCACGGTCCTCTCACCTGCCTGGCTGCCCTATCCATGTTGGAGCATCTCCAAGCTCGC
GCGGCCAAGTCTGGCCTGGCTGGCGCGGAAGTCGTCAAGCTTTCGGAGCAGGCTTTGAACGTCATTGTGTCGTTG
GTAGAACTGGTGCCGGATCGGGCGTTTCCAGCCGCCCGACCAGAAGCCGTGACCTCTTCATTCGCCTCCAACGCG
GATATAGTGAAGAGAGTCAGAGCATTCTATCTGGATCACCATGGCAACCTCGACTCCTCACCGCCACCGATTGAA
GCCATCGAATGCGGAGAGTTGTTGCTGCAGAAGGCTGTCAAATACACCGGCGACAACGACGACGACTTGGGGTCC
AACGAGGACCTGGGCTTGCGCGTTCGCATCTACACCCTCATGCTGCTCAAGACGCCGACAAGTTACAAGTTGGAC
GTGGAAAGATCAATGTCGCATTTGAAGGCACAGTTACAACAGACGTGCCCCCTACCCTTCTCCCACCTGTCGTCC
GTCCTACACCTTGCCACGCAGCTCTACTCGGCCGACAGAATCGACGCGACGCAGCTGTCGGAGATGGTGGGCCCT
CTGGTCTATCACGCGTGGTCCTACCTGGCAGCGTCCGATCCGAAATATCATGTAGAGACGGTTCGTTGCTTGTGG
CAACTGCAGACGGCCCTCACGCCGTGGAATCGTGAGATCGAAGCCGCCCTGTGCGGAATCCTGCTAGACTGCCAG
TCGAGGTTTGCTGAAGCTGCGCGCACCTTTGGCGTGCTCTGGTCGCATACGCTGCAAGACACGGCAGGCGACCGG
CGAGGGCCCAGGACGCCTATGCAGGAGTATCGACCAACGCTCAGACTTTCCGGCATGGAACACTACCCAGTCATG
CTGACCCAACCCCTTTTCCTCGTCTTGGACGCGTTGCTTGACGAGCGGACGCAAGCCTACATAGTGGTCAAGTCC
TGGCTCAACAACACCATCGGAATAGACAGACTCTTTCTCCTCTTCGTCACCAAGCTATCCGAGATGTCTTTCCTC
TCTTTCATAGCGAGCGACGGCAGCAAGACTGGTGCGGATCCGATCATGTTCAGTCGAGACGATGACTTGGATCTA
TGTCTGTACTACTTGCGCGCTCTTCGCCTCGTTCTTCGCTGTACCGGCGACGCTCCTCGCTCCGTTCTCGCCTCC
AGATATCTCTTCTTCGGCGGCGGACAAACGCAGATACGCGGTAGCGCTGAGGAGGGCGAGATGACGCTCCAGGAC
TACTTTATACGCGTATGCGCTGAATGCGTAACGGGGGAGGTGGTGTCCGGCGCCGACCAGGAGTTGGTCGAGCAG
ATCTCTCAGCTGCGTCGATACGCCTTGATTATCCTTGACGAGTTTTTATCGAGCCGCCACGGCCTTTCGATCGTT
CCGCATCAACTCGACAAGATCTTAATGGATAGGCTTGCCAAATCCATTGACACGCCGGATCCATATCTTCAAGTT
TTGCTGCTGGACGTCATTCTCGATACCCTCAAGCTACAGGAGACGACGCAGGGGGGGCGGCCGACCACTGCCACA
TCGGAGAGGATGTCTTCCATGACGGATCGCGCTCGTGCCGGTCGGACGTCAACTTCCATGAGCGAAAGCTCCCCG
GCCGGGCCGCAAATGCCGCCTCAGCTTCTGAAATGTCTGCAGGCCGGGCTCAGCTGCCCCAGCAGCCACTCTGTG
TTGGACAGCTGGATATCTTTCCTGGGGGACTGTCTGCCATTCTTCTCCCACTCCATCTTTCAGGTGCTGGTTCCG
CTCGTGGAGACGCTCTGCAGGCAGATAGGGGCAACGCTGTCGAATCTTCGCAACACATTCCAGGCGGGGCCGCAG
CCGTCCCGCAGCGGCGCGGGGGGCGCGCCCGAGTCGGCTCTCTTCTACCTCCTCAATGGATTGGAGCGTGTCCTG
GCCCTGGCGCATGACCAGCTGCTCACGGAGGAAACGCGAGCGCGGCTGTTGAAGGGGCCGGAGCAGACTCAGTCT
CTGTTGGGAAGCATGGTATCGGGCGTGTTCCAGTCGGAAAGCGCTCAGTCACGAAGCGCCACGGCCAACGATCGA
CTGACGGTCCACCTGGCGTTCCAGGACACGATGCGAACGTGCTACAAGATCTGGTCGTGGGGCCAGGGAGAGGAA
GGCAGGAAGCAGGAGCCTAGCTCGTTGGCATCCTTCAACTACACGTCACTGCGGATGAGGAACCGAGCGCGACGA
CTGCTGGAGCACCTGTTCGCGGCCGAGACGCTCGAGTGTCTGGAGACGGTGATTGGCATCTGGCGCTCTGCCGCC
GGTTCGGCCGAGGGCGGCCAGGTCTTGAACTTTCTGTCGGCTCTGGACGCCTGTCGGCCGAGGCACTGCGTCCCG
GCTCTCTTCAACTCCATCTACAGCCGGACCAACCCCGGTGCGTTGGACCCGTCGCGGAAGTCGGCCATGACCATT
TCTCTGCAAGACTTGGATCTCGTCGTCTTCCTGGTCGAATACGCGCGCTCCCTGGAGGACGATGCGATGGATGAG
ATCTGGGCCGACTGCATGACTTTCCTGCGAGACCTGCTGGGGAACCCGTTTCCGCACCGGCGAACGCTGCCGAGC
CTGCTCGAGTTCGCCGGCATATTGGGAGAGAAGGTGGACAAGACCAACTTTGGGGAGCAGCGAAGGATGCGTCGC
GAGCTGAGCGATTTATTCCTTCGCCTGCTCGCCGCACTCTTCACCACACGTCCCATGACGTTTGCCGAGCCCAAC
GGTCCGGCGGCGGAGAGGTCGACCGGCAGCAACCGGCGACGCACACTGAGCAGCGGCGGCGGCGGCGGCGACGGA
TCCGACCATGTTGTGCGCGTGCTGGCATCGATAGTCCCCAAGCTACCGCAGATCCTGCTAGAAAACGACCGGGTG
GTATCGGCGGCGACGACGATATCGACCAACGTCATCGGACCGGCACTGCGATCCCGAGCATTTCCGGACACCTTT
TCTCCCGACCTGATCCGGCTCCTGCTCGAGCTATCGCGGCTTCACAACGGACAGAAGGCGTGGAAGAAGGACGTG
GGCGAGGCCTTCAACGACGGCAGATTCTTCGGCACGAGGCCCGAGGTGGTCGAGGCCGACTGGCTCCCGCTGCTC
CGACAGTGGGCGGTGGCGGACAAGGAGAGGATGGGGGAGATTGTCGGACGCATCAGCGCGCCTACTACGGCCGGC
ATCGTCTTCGGCGTCGGCGCCACCTCGGCTCGGCTCGAGGCTGACCGGAGGACGCAGCTCAACCTCCGGCGGATG
GCGACTCTGGTGCTGGCTTCGGCCGACGACGGCTTCGTGGCCGATCTGCCCGTCGTCTTGGACAAGCTGGTGGAG
CTACTGGCGGCGACGCCCACGTCGTCTCCCTCTTCGACGACGCGGGCCGACGTCTTCCAGGTGGTGAGGGCGCTG
GTGCTCAAGACGAATCCAGTGCACCTGGCAGCGCTTTGGCCCGTCGTCAACGGCGAGATGCACGCGGCCATGTCG
TCGGTCGTCGACGCTCCCGACGACCACAGCATGGCGAGCGAGACGTACGCGCCGTCGGCCGTAGTCGAGGCCTGC
AAGCTGCTAGACGTGCTGGTTTGCGTCGCTCCCGACGACTTTCAGCTGCACGAATGGCTCTTCGTCACCGACACC
ATCGACGCCGTCTACCGGCCCTCGGCGTACCGGCCCGTCGCCCTCGTCGACGAGCTGGCCGACGAGCTGGGTGGG
GTGGGCGGCGGAGGAGGAGGAGGCGAGGCGGCCACGACGACGACGGTATCTTGGGGGGGCCAAGACGACGACGTG
GATGCCGGTCCCCGCCGGCCGCTGCTGCTGCCGCTTGCCGGAGGCGACGTTCCGGAGCGCAAGGATGATCTGGTG
GCGACGGTGCTGAGGCCGTTCTTCGCACAGCTCACCATCTTTGCCTTTGAGTCGACGTACGCCATGGGGGTGCTG
GATCGGGAGGCTTGTATTGGCGGCCTGTTGAGGGATCTGTTTGACGAGCGTTCCATGGTGAGGGCCATG
Transcript >Ophio5|4389
ATGGCGCTTGAACAGGCTTCCGGCGTCTACTCGGCGTCTCCCGAAAGCTCTGGACGCGAATCGCCAGTCCCCCGA
GGCTGGAGGAACCAAGACGAGCTTCCGATCAAGGACAAGGCGTATCGCAAGTATGCCTCGGCCGTCGAAAAAGTC
CTTTCACAGTTCGAGACGGCCTTGGAGGAGTGGGCCGACTACATCTCCTTTCTAAACAGGCTGCTCAAGTCCCTA
CAGGCCCGGCCCGCGTCCATCACTACGATACCGGCCAAGGCCATCGTCGCCAAGCGTCTGTCTCAGTGCCTCAAC
CCCGCCCTGCCGTCGGGCGTTCATCAAAAGGCCCTCGAGGTCTATAGCTACGTCTTTTCCGTTATTGGAAAAGAA
GGCTTGTCACGACATCTATCTCTCTACCTACCGGGTCTGGCACCGACACTCTCCTTCGCCTCGCTCTCCGTCCGA
GCGCCTTTCCTCGACCTCCTAGAGACGCATGTCCTTCGGGCCGATCCGCGCTCTCTCCGGCCGGCCATCAAGTCC
ATCATATTAGCGTTGCTTCCGGGCCTGGAAGATGAGACGAGCGAGGACTTCGATCGCACCCTGAGTCTCGTCACG
AGTTTCAAGAAAGCCATCAGGCCCCCGGAGAGCGAACAGATTGATCAACACCACTCCTCCGGAGATTCCTTCTTC
TGGCAATGCTTTTTCTTGGCTTCAATCACAGGCCACAGCCGTCGCTCCGGAGCGTTGGCATATTTGAACCATAAT
CTACCTGTTTTGGCCCCCGTTTCATCCAGCAGCCCTCCCGTTGCCACCTCTCAAGAAGATGATGCAGATGAGAGC
TGCAAGACGGCACTCGTTGTGACCTCCCCCGAGCCGGGACTTTTGGTACGGTGCTTTGCCAGCGGTTTGGCAGAT
GATCAGCTATTAATCCAGCGGGGCTTTCTCGATCTCTTGGTGTCCCATCTACCCCTGAATTCGAGCGTGCTGCAG
TCCCGCGTAAAGTCTGCCGACCTCAAGCTACTTGTCGAGGCCGCGGCCGGTGTGGTAACGCGGCGGGACATGAGT
TTGAACAGGCGGCTATGGGCATGGCTGCTTGGTCCGGAGCCAACCGGTAACGAAGGGGAGAGCGTCGGCGACCCG
ACGACGCCCTCGCGCGAGCAGCAGCAGCCGTCCCTATCGCCCAGGACCAACTATTTTGAAGAATTCGGGCTGCAG
CCGCTGACGAGAGCCTTGCTGGATATGATTAGGGGAGCTTCCAGCGGCACCGCTACCGAACGAGCTCGGCCGTAC
CGGATATGTCTCTCTCTGATGGACAAGTGGGAGATTGGGGGGCTGGTTGTTCCCGAAGTCTTTTTGCCTGTCGTG
GAGAGCGTCCGGCAGTACCACAGCCGGGCGCCGGCCAAGGCTGACTTCGCCGAGGTTTTGCGCAGTGCCAGCGTA
TTCTTCGACGGCATCGAGAGCGGCCTCATCTTCAGCGAGATGTTCCGGCTACTGGCTCAGGCTCTCGGCGTCGAA
AGTATCAGCATGGGCGAGCGAATGGACAAAATCTCTCTCGTCGGTTTCATCGTCGCAAACTTCAACGTCCGCGAA
GAGGAGATGGTCACAATCCACGGTCCTCTCACCTGCCTGGCTGCCCTATCCATGTTGGAGCATCTCCAAGCTCGC
GCGGCCAAGTCTGGCCTGGCTGGCGCGGAAGTCGTCAAGCTTTCGGAGCAGGCTTTGAACGTCATTGTGTCGTTG
GTAGAACTGGTGCCGGATCGGGCGTTTCCAGCCGCCCGACCAGAAGCCGTGACCTCTTCATTCGCCTCCAACGCG
GATATAGTGAAGAGAGTCAGAGCATTCTATCTGGATCACCATGGCAACCTCGACTCCTCACCGCCACCGATTGAA
GCCATCGAATGCGGAGAGTTGTTGCTGCAGAAGGCTGTCAAATACACCGGCGACAACGACGACGACTTGGGGTCC
AACGAGGACCTGGGCTTGCGCGTTCGCATCTACACCCTCATGCTGCTCAAGACGCCGACAAGTTACAAGTTGGAC
GTGGAAAGATCAATGTCGCATTTGAAGGCACAGTTACAACAGACGTGCCCCCTACCCTTCTCCCACCTGTCGTCC
GTCCTACACCTTGCCACGCAGCTCTACTCGGCCGACAGAATCGACGCGACGCAGCTGTCGGAGATGGTGGGCCCT
CTGGTCTATCACGCGTGGTCCTACCTGGCAGCGTCCGATCCGAAATATCATGTAGAGACGGTTCGTTGCTTGTGG
CAACTGCAGACGGCCCTCACGCCGTGGAATCGTGAGATCGAAGCCGCCCTGTGCGGAATCCTGCTAGACTGCCAG
TCGAGGTTTGCTGAAGCTGCGCGCACCTTTGGCGTGCTCTGGTCGCATACGCTGCAAGACACGGCAGGCGACCGG
CGAGGGCCCAGGACGCCTATGCAGGAGTATCGACCAACGCTCAGACTTTCCGGCATGGAACACTACCCAGTCATG
CTGACCCAACCCCTTTTCCTCGTCTTGGACGCGTTGCTTGACGAGCGGACGCAAGCCTACATAGTGGTCAAGTCC
TGGCTCAACAACACCATCGGAATAGACAGACTCTTTCTCCTCTTCGTCACCAAGCTATCCGAGATGTCTTTCCTC
TCTTTCATAGCGAGCGACGGCAGCAAGACTGGTGCGGATCCGATCATGTTCAGTCGAGACGATGACTTGGATCTA
TGTCTGTACTACTTGCGCGCTCTTCGCCTCGTTCTTCGCTGTACCGGCGACGCTCCTCGCTCCGTTCTCGCCTCC
AGATATCTCTTCTTCGGCGGCGGACAAACGCAGATACGCGGTAGCGCTGAGGAGGGCGAGATGACGCTCCAGGAC
TACTTTATACGCGTATGCGCTGAATGCGTAACGGGGGAGGTGGTGTCCGGCGCCGACCAGGAGTTGGTCGAGCAG
ATCTCTCAGCTGCGTCGATACGCCTTGATTATCCTTGACGAGTTTTTATCGAGCCGCCACGGCCTTTCGATCGTT
CCGCATCAACTCGACAAGATCTTAATGGATAGGCTTGCCAAATCCATTGACACGCCGGATCCATATCTTCAAGTT
TTGCTGCTGGACGTCATTCTCGATACCCTCAAGCTACAGGAGACGACGCAGGGGGGGCGGCCGACCACTGCCACA
TCGGAGAGGATGTCTTCCATGACGGATCGCGCTCGTGCCGGTCGGACGTCAACTTCCATGAGCGAAAGCTCCCCG
GCCGGGCCGCAAATGCCGCCTCAGCTTCTGAAATGTCTGCAGGCCGGGCTCAGCTGCCCCAGCAGCCACTCTGTG
TTGGACAGCTGGATATCTTTCCTGGGGGACTGTCTGCCATTCTTCTCCCACTCCATCTTTCAGGTGCTGGTTCCG
CTCGTGGAGACGCTCTGCAGGCAGATAGGGGCAACGCTGTCGAATCTTCGCAACACATTCCAGGCGGGGCCGCAG
CCGTCCCGCAGCGGCGCGGGGGGCGCGCCCGAGTCGGCTCTCTTCTACCTCCTCAATGGATTGGAGCGTGTCCTG
GCCCTGGCGCATGACCAGCTGCTCACGGAGGAAACGCGAGCGCGGCTGTTGAAGGGGCCGGAGCAGACTCAGTCT
CTGTTGGGAAGCATGGTATCGGGCGTGTTCCAGTCGGAAAGCGCTCAGTCACGAAGCGCCACGGCCAACGATCGA
CTGACGGTCCACCTGGCGTTCCAGGACACGATGCGAACGTGCTACAAGATCTGGTCGTGGGGCCAGGGAGAGGAA
GGCAGGAAGCAGGAGCCTAGCTCGTTGGCATCCTTCAACTACACGTCACTGCGGATGAGGAACCGAGCGCGACGA
CTGCTGGAGCACCTGTTCGCGGCCGAGACGCTCGAGTGTCTGGAGACGGTGATTGGCATCTGGCGCTCTGCCGCC
GGTTCGGCCGAGGGCGGCCAGGTCTTGAACTTTCTGTCGGCTCTGGACGCCTGTCGGCCGAGGCACTGCGTCCCG
GCTCTCTTCAACTCCATCTACAGCCGGACCAACCCCGGTGCGTTGGACCCGTCGCGGAAGTCGGCCATGACCATT
TCTCTGCAAGACTTGGATCTCGTCGTCTTCCTGGTCGAATACGCGCGCTCCCTGGAGGACGATGCGATGGATGAG
ATCTGGGCCGACTGCATGACTTTCCTGCGAGACCTGCTGGGGAACCCGTTTCCGCACCGGCGAACGCTGCCGAGC
CTGCTCGAGTTCGCCGGCATATTGGGAGAGAAGGTGGACAAGACCAACTTTGGGGAGCAGCGAAGGATGCGTCGC
GAGCTGAGCGATTTATTCCTTCGCCTGCTCGCCGCACTCTTCACCACACGTCCCATGACGTTTGCCGAGCCCAAC
GGTCCGGCGGCGGAGAGGTCGACCGGCAGCAACCGGCGACGCACACTGAGCAGCGGCGGCGGCGGCGGCGACGGA
TCCGACCATGTTGTGCGCGTGCTGGCATCGATAGTCCCCAAGCTACCGCAGATCCTGCTAGAAAACGACCGGGTG
GTATCGGCGGCGACGACGATATCGACCAACGTCATCGGACCGGCACTGCGATCCCGAGCATTTCCGGACACCTTT
TCTCCCGACCTGATCCGGCTCCTGCTCGAGCTATCGCGGCTTCACAACGGACAGAAGGCGTGGAAGAAGGACGTG
GGCGAGGCCTTCAACGACGGCAGATTCTTCGGCACGAGGCCCGAGGTGGTCGAGGCCGACTGGCTCCCGCTGCTC
CGACAGTGGGCGGTGGCGGACAAGGAGAGGATGGGGGAGATTGTCGGACGCATCAGCGCGCCTACTACGGCCGGC
ATCGTCTTCGGCGTCGGCGCCACCTCGGCTCGGCTCGAGGCTGACCGGAGGACGCAGCTCAACCTCCGGCGGATG
GCGACTCTGGTGCTGGCTTCGGCCGACGACGGCTTCGTGGCCGATCTGCCCGTCGTCTTGGACAAGCTGGTGGAG
CTACTGGCGGCGACGCCCACGTCGTCTCCCTCTTCGACGACGCGGGCCGACGTCTTCCAGGTGGTGAGGGCGCTG
GTGCTCAAGACGAATCCAGTGCACCTGGCAGCGCTTTGGCCCGTCGTCAACGGCGAGATGCACGCGGCCATGTCG
TCGGTCGTCGACGCTCCCGACGACCACAGCATGGCGAGCGAGACGTACGCGCCGTCGGCCGTAGTCGAGGCCTGC
AAGCTGCTAGACGTGCTGGTTTGCGTCGCTCCCGACGACTTTCAGCTGCACGAATGGCTCTTCGTCACCGACACC
ATCGACGCCGTCTACCGGCCCTCGGCGTACCGGCCCGTCGCCCTCGTCGACGAGCTGGCCGACGAGCTGGGTGGG
GTGGGCGGCGGAGGAGGAGGAGGCGAGGCGGCCACGACGACGACGGTATCTTGGGGGGGCCAAGACGACGACGTG
GATGCCGGTCCCCGCCGGCCGCTGCTGCTGCCGCTTGCCGGAGGCGACGTTCCGGAGCGCAAGGATGATCTGGTG
GCGACGGTGCTGAGGCCGTTCTTCGCACAGCTCACCATCTTTGCCTTTGAGTCGACGTACGCCATGGGGGTGCTG
GATCGGGAGGCTTGTATTGGCGGCCTGTTGAGGGATCTGTTTGACGAGCGTTCCATGGTGAGGGCCATGTGA
Gene >Ophio5|4389
ATGGCGCTTGAACAGGCTTCCGGCGTCTACTCGGCGTCTCCCGAAAGCTCTGGACGCGAATCGCCAGTCCCCCGA
GGCTGGAGGAACCAAGGTGCGCGCGCACCTCCGTCTCTGCCTCGCAGGGCGCCGTCTGTCTGACCAGAAGCTCCA
GACGAGCTTCCGATCAAGGACAAGGCGTATCGCAAGTATGCCTCGGCCGTCGAAAAAGTCCTTTCACAGTTCGAG
ACGGCCTTGGAGGAGTGGGCCGACTACATCTCCTTTCTAAACAGGCTGCTCAAGGTATAACGGCTGCTCCAAGTC
AAGCGCTCGCGCTCATCACCCTCGACAGTCCCTACAGGCCCGGCCCGCGTCCATCACTACGATACCGGCCAAGGC
CATCGTCGCCAAGCGTCTGTCTCAGTGCCTCAACCCCGCCCTGCCGTCGGGCGTTCATCAAAAGGCCCTCGAGGT
CTATAGCTACGTCTTTTCCGTTATTGGAAAAGAAGGCTTGTCACGACATCTATCTCTCTACCTACCGGGTCTGGC
ACCGACACTCTCCTTCGCCTCGCTCTCCGTCCGAGCGCCTTTCCTCGACCTCCTAGAGACGCATGTCCTTCGGGC
CGATCCGCGCTCTCTCCGGCCGGCCATCAAGTCCATCATATTAGCGTTGCTTCCGGGCCTGGAAGATGAGACGAG
CGAGGACTTCGATCGCACCCTGAGTCTCGTCACGAGTTTCAAGAAAGCCATCAGGCCCCCGGAGAGCGAACAGAT
TGATCAACACCACTCCTCCGGAGATTCCTTCTTCTGGCAATGCTTTTTCTTGGCTTCAATCACAGGCCACAGCCG
TCGCTCCGGAGCGTTGGCATATTTGAACCATAATCTACCTGTTTTGGCCCCCGTTTCATCCAGCAGCCCTCCCGT
TGCCACCTCTCAAGAAGATGATGCAGATGAGAGCTGCAAGACGGCACTCGTTGTGACCTCCCCCGAGCCGGGACT
TTTGGTACGGTGCTTTGCCAGCGGTTTGGCAGATGATCAGCTATTAATCCAGCGGGGCTTTCTCGATCTCTTGGT
GTCCCATCTACCCCTGAATTCGAGCGTGCTGCAGTCCCGCGTAAAGTCTGCCGACCTCAAGCTACTTGTCGAGGC
CGCGGCCGGTGTGGTAACGCGGCGGGACATGAGTTTGAACAGGCGGCTATGGGCATGGCTGCTTGGTCCGGAGCC
AACCGGTAACGAAGGGGAGAGCGTCGGCGACCCGACGACGCCCTCGCGCGAGCAGCAGCAGCCGTCCCTATCGCC
CAGGACCAACTATTTTGAAGAATTCGGGCTGCAGCCGCTGACGAGAGCCTTGCTGGATATGATTAGGGGAGCTTC
CAGCGGCACCGCTACCGAACGAGCTCGGCCGTACCGGATATGTCTCTCTCTGATGGACAAGTGGGAGATTGGGGG
GCTGGTTGTTCCCGAAGTCTTTTTGCCTGTCGTGGAGAGCGTCCGGCAGTACCACAGCCGGGCGCCGGCCAAGGC
TGACTTCGCCGAGGTTTTGCGCAGTGCCAGCGTATTCTTCGACGGCATCGAGAGCGGCCTCATCTTCAGCGAGAT
GTTCCGGCTACTGGCTCAGGCTCTCGGCGTCGAAAGTATCAGCATGGGCGAGCGAATGGACAAAATCTCTCTCGT
CGGTTTCATCGTCGCAAACTTCAACGTCCGCGAAGAGGAGATGGTCACAATCCACGGTCCTCTCACCTGCCTGGC
TGCCCTATCCATGTTGGAGCATCTCCAAGCTCGCGCGGCCAAGTCTGGCCTGGCTGGCGCGGAAGTCGTCAAGCT
TTCGGAGCAGGCTTTGAACGTCATTGTGTCGTTGGTAGAACTGGTGCCGGATCGGGCGTTTCCAGCCGCCCGACC
AGAAGCCGTGACCTCTTCATTCGCCTCCAACGCGGATATAGTGAAGAGAGTCAGAGCATTCTATCTGGATCACCA
TGGCAACCTCGACTCCTCACCGCCACCGATTGAAGCCATCGAATGCGGAGAGTTGTTGCTGCAGAAGGCTGTCAA
ATACACCGGCGACAACGACGACGACTTGGGGTCCAACGAGGACCTGGGCTTGCGCGTTCGCATCTACACCCTCAT
GCTGCTCAAGACGCCGACAAGTTACAAGTTGGACGTGGAAAGATCAATGTCGCATTTGAAGGCACAGTTACAACA
GACGTGCCCCCTACCCTTCTCCCACCTGTCGTCCGTCCTACACCTTGCCACGCAGCTCTACTCGGCCGACAGAAT
CGACGCGACGCAGCTGTCGGAGATGGTGGGCCCTCTGGTCTATCACGCGTGGTCCTACCTGGCAGCGTCCGATCC
GAAATATCATGTAGAGACGGTTCGTTGCTTGTGGCAACTGCAGACGGCCCTCACGCCGTGGAATCGTGAGATCGA
AGCCGCCCTGTGCGGAATCCTGCTAGACTGCCAGTCGAGGTTTGCTGAAGCTGCGCGCACCTTTGGCGTGCTCTG
GTCGCATACGCTGCAAGACACGGCAGGCGACCGGCGAGGGCCCAGGACGCCTATGCAGGAGTATCGACCAACGCT
CAGACTTTCCGGCATGGAACACTACCCAGTCATGCTGACCCAACCCCTTTTCCTCGTCTTGGACGCGTTGCTTGA
CGAGCGGACGCAAGCCTACATAGTGGTCAAGTCCTGGCTCAACAACACCATCGGAATAGACAGGTAAGGTGGCCG
GCCCTCGTGTGTCCGGGCTGCTCCTTGCTGACGGGGCCCAGACTCTTTCTCCTCTTCGTCACCAAGCTATCCGAG
ATGTCTTTCCTCTCTTTCATAGCGAGCGACGGCAGCAAGACTGGTGCGGATCCGATCATGTTCAGTCGAGACGAT
GACTTGGATCTATGTCTGTACTACTTGCGCGCTCTTCGCCTCGTTCTTCGCTGTACCGGCGACGCTCCTCGCTCC
GTTCTCGCCTCCAGATATCTCTTCTTCGGCGGCGGACAAACGCAGATACGCGGTTTGTTTTTCCCTTTACCGCGC
TGGCCGGTACGCGCGGCTAACGATGGTGTGTAGGTAGCGCTGAGGAGGGCGAGATGACGCTCCAGGACTACTTTA
TACGCGTATGCGCTGAATGCGTAACGGGGGAGGTGGTGTCCGGCGCCGACCAGGAGTTGGTCGAGCAGATCTCTC
AGCTGCGTCGATACGCCTTGATTATCCTTGACGAGTTTTTATCGAGCCGCCACGGCCTTTCGATCGTTCCGCATC
AACTCGACAAGATCTTAATGGATAGGCTTGCCAAATCCATTGACACGCCGGATCCATATCTTCAAGTTTTGCTGC
TGGACGTCATTCTCGATACCCTCAAGCTACAGGAGACGACGCAGGGGGGGCGGCCGACCACTGCCACATCGGAGA
GGATGTCTTCCATGACGGATCGCGCTCGTGCCGGTCGGACGTCAACTTCCATGAGCGAAAGCTCCCCGGCCGGGC
CGCAAATGCCGCCTCAGCTTCTGAAATGTCTGCAGGCCGGGCTCAGCTGCCCCAGCAGCCACTCTGTGTTGGACA
GCTGGATATCTTTCCTGGGGGACTGTCTGCCATTCTTCTCCCACTCCATCTTTCAGGTGCTGGTTCCGCTCGTGG
AGACGCTCTGCAGGCAGATAGGGGCAACGCTGTCGAATCTTCGCAACACATTCCAGGCGGGGCCGCAGCCGTCCC
GCAGCGGCGCGGGGGGCGCGCCCGAGTCGGCTCTCTTCTACCTCCTCAATGGATTGGAGCGTGTCCTGGCCCTGG
CGCATGACCAGCTGCTCACGGAGGAAACGCGAGCGCGGCTGTTGAAGGGGCCGGAGCAGACTCAGTCTCTGTTGG
GAAGCATGGTATCGGGCGTGTTCCAGTCGGAAAGCGCTCAGTCACGAAGCGCCACGGCCAACGATCGACTGACGG
TCCACCTGGCGTTCCAGGACACGATGCGAACGTGCTACAAGATCTGGTCGTGGGGCCAGGGAGAGGAAGGCAGGA
AGCAGGAGCCTAGCTCGTTGGCATCCTTCAACTACACGTCACTGCGGATGAGGAACCGAGCGCGACGACTGCTGG
AGCACCTGTTCGCGGCCGAGACGCTCGAGTGTCTGGAGACGGTGATTGGCATCTGGCGCTCTGCCGCCGGTTCGG
CCGAGGGCGGCCAGGTCTTGAACTTTCTGTCGGCTCTGGACGCCTGTCGGCCGAGGCACTGCGTCCCGGCTCTCT
TCAACTCCATCTACAGCCGGACCAACCCCGGTGCGTTGGACCCGTCGCGGAAGTCGGCCATGACCATTTCTCTGC
AAGACTTGGATCTCGTCGTCTTCCTGGTCGAATACGCGCGCTCCCTGGAGGACGATGCGATGGATGAGATCTGGG
CCGACTGCATGACTTTCCTGCGAGACCTGCTGGGGAACCCGTTTCCGCACCGGCGAACGCTGCCGAGCCTGCTCG
AGTTCGCCGGCATATTGGGAGAGAAGGTGGACAAGACCAACTTTGGGGAGCAGCGAAGGATGCGTCGCGAGCTGA
GCGTCAGTCGATCGATTCCCGCCTGTTTTGTTACGTACGTGGCTGACAAGGAAGCAGGATTTATTCCTTCGCCTG
CTCGCCGCACTCTTCACCACACGTCCCATGACGTTTGCCGAGCCCAACGGTCCGGCGGCGGAGAGGTCGACCGGC
AGCAACCGGCGACGCACACTGAGCAGCGGCGGCGGCGGCGGCGACGGATCCGACCATGTTGTGCGCGTGCTGGCA
TCGATAGTCCCCAAGCTACCGCAGATCCTGCTAGAAAACGACCGGGTGGTATCGGCGGCGACGACGATATCGACC
AACGTCATCGGACCGGCACTGCGATCCCGAGCATTTCCGGACACCTTTTCTCCCGACCTGATCCGGCTCCTGCTC
GAGCTATCGCGGCTTCACAACGGACAGAAGGCGTGGAAGAAGGACGTGGGCGAGGCCTTCAACGACGGCAGATTC
TTCGGCACGAGGCCCGAGGTGGTCGAGGCCGACTGGCTCCCGCTGCTCCGACAGTGGGCGGTGGCGGACAAGGAG
AGGATGGGGGAGATTGTCGGACGCATCAGCGCGCCTACTACGGCCGGCATCGTCTTCGGCGTCGGCGCCACCTCG
GCTCGGCTCGAGGCTGACCGGAGGACGCAGCTCAACCTCCGGCGGATGGCGACTCTGGTGCTGGCTTCGGCCGAC
GACGGCTTCGTGGCCGATCTGCCCGTCGTCTTGGACAAGCTGGTGGAGCTACTGGCGGCGACGCCCACGTCGTCT
CCCTCTTCGACGACGCGGGCCGACGTCTTCCAGGTGGTGAGGGCGCTGGTGCTCAAGACGAATCCAGTGCACCTG
GCAGCGCTTTGGCCCGTCGTCAACGGCGAGATGCACGCGGCCATGTCGTCGGTCGTCGACGCTCCCGACGACCAC
AGCATGGCGAGCGAGACGTACGCGCCGTCGGCCGTAGTCGAGGCCTGCAAGCTGCTAGACGTGCTGGTTTGCGTC
GCTCCCGACGACTTTCAGCTGCACGAATGGCTCTTCGTCACCGACACCATCGACGCCGTCTACCGGCCCTCGGCG
TACCGGCCCGTCGCCCTCGTCGACGAGCTGGCCGACGAGCTGGGTGGGGTGGGCGGCGGAGGAGGAGGAGGCGAG
GCGGCCACGACGACGACGGTATCTTGGGGGGGCCAAGACGACGACGTGGATGCCGGTCCCCGCCGGCCGCTGCTG
CTGCCGCTTGCCGGAGGCGACGTTCCGGAGCGCAAGGATGATCTGGTGGCGACGGTGCTGAGGCCGTTCTTCGCA
CAGCTCACCATCTTTGCCTTTGAGTCGACGTACGCCATGGGGGTGCTGGATCGGGAGGCTTGTATTGGCGGCCTG
TTGAGGGATCTGTTTGACGAGCGTTCCATGGTGAGGGCCATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail