Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4387
Gene name
Locationscaffold_348:13939..17615
Strand+
Gene length (bp)3676
Transcript length (bp)3426
Coding sequence length (bp)3423
Protein length (aa) 1141

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15411 PH_10 Pleckstrin homology domain 4.1E-25 408 519
PF00092 VWA von Willebrand factor type A domain 6.6E-15 595 760
PF13768 VWA_3 von Willebrand factor type A domain 2.2E-12 595 748
PF13519 VWA_2 von Willebrand factor type A domain 1.6E-06 596 704

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.6389 0.3655 0.1678 0.1725 0.1023 0.0178 0.1156 0.2962 0.1868 0.0321

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4527
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6984
Ophiocordyceps australis map64 (Brazil) OphauB2|5175
Ophiocordyceps camponoti-floridani Ophcf2|06524
Ophiocordyceps camponoti-rufipedis Ophun1|6830
Ophiocordyceps kimflemingae Ophio5|4387 (this protein)
Ophiocordyceps subramaniannii Hirsu2|9461

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4387
MFSRVRRSQRQRTGDAGPPSLDPKKGPNLSTDLSLIVGNPKGPPRSRPLANQSVFLEKGSIYSDDLASLRRDSFA
SSASSPVFGTAHRRVGAIDNNVMASTVERARHRRERTFVGSECACCEEPLEHTLQGERILQFSCSHVSHEACFYE
FIREVDSQHCPTCDAPLHLDTSRGGNVIDINKISNMMRSTGSDSRSASTPTPSWDNQTVRSPSIGSSQKNLPALP
SGGNRREMARGGSFRDGREPALSDRYDSSRHTRSDSEATYVASSSGYTETSQSGLSRRHDYDLQAMESSPGSPRA
MFRNPIPAPTVTVRSEFPSINRSRQQQTLTCLITVESASNKWRPDLEDIGVQPLQLPSLDARMDEGMARSAVTTP
ARPYPYESAEVLEEMTEHLRNRVDSWHGLDFDSFGPLRLYGTLRVGKNKVSWQVLECYLFAEILICVKEKKLPEH
WDDYGSPQRAATRCTLKGSILIKKHLSEVVETGTIDENLLTLTLTAGELPQFHLKFDNRNQLKLWNQALLDLIIG
DDSPVRIPDYDHGDTSETDEEIDWHWSRSHRVSSAASSWGPKSATTAPTEYTSFTARSPRLGSPMHVPIDVVVVV
PISSSMQGVKINLVRDALKFMIGNLGERDRLGIVTFGSASGGTSIVGMMTKSYADWPKVLASIKPVGQKSPRADV
VEGANVAMNQLMQRKHSNPIATIMLISDASTADPDSVDFVVSRAEAAKITIHSFGLGTSHKPDTMIELSTRTKAS
YTYVKDWMMLRECLGGCLGGLQTLSHQNVKLMLKLPEGSPAKFHKISGALQITKRSAGRDAEANLGDLRFGDKRD
VLVQLVITPDTTSQEQLPQDPWDNIVSGLEALGGSVDQEVERAMSVEEVPMIQADLSWGDILRDGTMGKMPRPSL
LTVSMLPAVAGQKKPWGTPPIPPHPSIVQRRMELLTSDMLTRALTLVSRGQHDRAHTLLNETRSILKGLGKGGLP
PVPPPPNSKSAPSTPHPTGDATPNAAGTPDRKRSPSPPTSAASSGGSGSGSGSGSGNGFSAGRLARSRSNDGFGP
GIGIDPGTVAALDAELESSLEWINHPAVFGRDSRKAVLQAIGVISSQRAFTFRSPIESLWAGRVGGIKRLADKSR
EWREEGGGEGGIMEEA
Coding >Ophio5|4387
ATGTTCAGTCGCGTTCGACGAAGCCAGCGGCAGCGCACCGGCGACGCGGGCCCGCCCTCCTTGGATCCTAAGAAA
GGCCCGAACTTGTCGACGGACCTGAGCCTAATCGTCGGCAATCCCAAGGGTCCTCCCCGTTCGAGACCCCTGGCC
AACCAGTCCGTCTTTCTCGAGAAGGGCAGTATCTATTCCGACGACTTGGCCAGCCTGCGTCGTGATTCCTTTGCG
AGTTCAGCTTCTTCCCCCGTCTTCGGCACCGCCCATCGGAGAGTCGGTGCCATCGATAATAACGTCATGGCGAGC
ACCGTTGAGCGCGCTCGCCATCGTCGCGAGCGCACATTTGTCGGCAGCGAATGCGCCTGTTGCGAGGAGCCCCTC
GAGCATACTCTGCAGGGCGAGCGCATCCTCCAGTTTTCCTGCTCCCACGTCTCCCACGAGGCCTGTTTCTACGAG
TTCATCCGCGAAGTCGACTCCCAACACTGCCCAACATGCGATGCTCCGCTGCATCTCGACACCAGCCGTGGCGGC
AATGTCATTGACATCAACAAAATTAGCAACATGATGCGCTCCACCGGCAGTGATTCCCGCTCCGCCAGCACGCCC
ACCCCGAGTTGGGACAACCAGACGGTGAGGTCGCCGAGCATCGGCAGCTCTCAAAAGAACCTCCCGGCCCTGCCG
TCAGGCGGCAATCGGAGGGAGATGGCGAGGGGCGGCAGCTTCAGAGACGGTCGCGAGCCTGCCCTGTCCGACCGC
TACGACTCCTCGAGACATACGCGCAGCGATAGCGAGGCCACCTACGTCGCCTCGTCGAGCGGATACACCGAAACG
TCACAGAGCGGCCTCTCCCGCCGTCACGACTACGACCTGCAGGCCATGGAGTCGTCACCGGGCAGCCCGCGTGCC
ATGTTCCGCAATCCGATCCCCGCCCCGACCGTCACGGTCCGATCCGAGTTTCCGTCCATCAACAGGTCTCGCCAA
CAGCAGACGCTCACCTGCCTCATCACCGTCGAGTCCGCTAGCAACAAATGGAGGCCTGACCTCGAGGACATTGGT
GTCCAGCCGCTGCAGCTGCCGTCGCTCGACGCTCGGATGGACGAGGGCATGGCGCGTTCAGCCGTCACGACGCCC
GCTCGCCCGTACCCTTACGAGTCTGCCGAGGTGCTGGAAGAGATGACGGAGCACCTGCGGAACCGCGTCGACAGC
TGGCACGGTCTGGATTTCGACAGTTTCGGACCCCTGCGCCTCTATGGCACGCTCCGAGTCGGCAAGAACAAGGTT
TCATGGCAGGTCCTGGAATGCTACCTCTTTGCTGAGATACTCATCTGCGTCAAGGAGAAGAAGCTGCCGGAACAT
TGGGACGACTACGGCAGCCCTCAGAGAGCGGCGACCCGCTGCACGCTCAAGGGCTCCATTCTCATCAAGAAGCAC
CTTAGCGAGGTGGTCGAGACCGGCACCATCGATGAGAATCTCCTGACTCTGACACTGACCGCGGGCGAGCTGCCC
CAGTTCCACCTCAAGTTTGACAACCGCAACCAGCTCAAGCTCTGGAACCAGGCGCTCCTGGACCTCATCATCGGC
GACGACTCTCCCGTCCGCATCCCTGACTACGACCACGGTGACACGTCCGAGACGGATGAGGAGATTGACTGGCAT
TGGTCGCGGTCCCATCGAGTCTCGTCGGCGGCCTCGTCATGGGGCCCCAAGTCGGCTACGACGGCACCGACGGAA
TATACGTCCTTTACCGCGAGGAGTCCCAGGCTGGGCAGCCCGATGCACGTGCCCATCGACGTCGTCGTCGTCGTA
CCCATCTCGTCGTCGATGCAGGGCGTCAAGATCAATCTGGTCCGCGACGCCCTCAAGTTCATGATTGGCAACCTC
GGCGAACGCGACCGGCTCGGCATCGTCACCTTCGGCTCGGCCAGCGGCGGCACGTCCATTGTCGGCATGATGACC
AAGTCGTACGCAGATTGGCCCAAGGTGCTGGCGTCCATCAAACCCGTGGGCCAGAAGAGCCCCCGGGCCGACGTG
GTCGAGGGCGCCAACGTGGCCATGAACCAGCTCATGCAGCGCAAGCACAGCAACCCCATCGCCACCATCATGCTC
ATCAGCGACGCGTCCACGGCCGACCCCGACTCGGTCGACTTCGTCGTCTCCCGCGCCGAGGCGGCCAAGATCACC
ATCCACTCGTTTGGCCTCGGCACGTCGCACAAGCCGGACACCATGATTGAGTTGTCGACGCGGACCAAGGCCTCG
TACACGTACGTCAAGGACTGGATGATGCTGCGCGAGTGCCTGGGCGGCTGCCTGGGTGGCCTACAGACGCTGTCG
CACCAAAATGTCAAGCTCATGCTCAAGCTTCCCGAGGGATCGCCGGCCAAGTTTCACAAGATTAGCGGCGCGCTG
CAGATCACCAAGCGCTCCGCGGGCCGCGACGCCGAGGCGAACCTCGGCGACCTGCGCTTCGGTGACAAGCGCGAC
GTGCTGGTTCAGCTCGTCATCACGCCCGACACCACGTCCCAGGAGCAGCTGCCGCAGGATCCGTGGGACAACATC
GTTTCCGGCCTCGAAGCCCTGGGCGGCTCCGTCGACCAAGAGGTAGAGCGTGCCATGTCGGTCGAGGAGGTTCCC
ATGATTCAGGCCGACCTCAGCTGGGGTGACATTTTGCGTGACGGCACCATGGGGAAAATGCCGAGGCCGTCTCTA
CTGACAGTTTCGATGCTGCCGGCCGTCGCCGGACAAAAGAAGCCGTGGGGGACGCCTCCGATCCCCCCGCACCCC
AGCATCGTCCAGCGGCGGATGGAGCTGCTGACGTCGGATATGTTGACGCGGGCCCTGACGCTCGTCAGCCGCGGC
CAGCACGACCGGGCGCACACGCTGCTCAACGAGACGCGATCGATCCTCAAGGGCCTCGGCAAGGGCGGCCTACCC
CCGGTGCCGCCGCCTCCGAACAGCAAGTCGGCCCCTTCGACGCCGCACCCGACGGGGGACGCGACGCCCAACGCG
GCAGGGACCCCGGACCGGAAGCGGAGCCCCTCCCCCCCCACGTCGGCCGCGTCGTCCGGCGGCAGCGGCAGCGGC
AGCGGAAGCGGAAGCGGCAACGGCTTCTCGGCCGGGCGGCTCGCCCGCAGCCGGTCCAACGACGGCTTCGGCCCC
GGCATAGGCATCGACCCGGGCACGGTGGCGGCGCTGGATGCGGAGCTGGAGAGCAGCCTCGAGTGGATCAACCAT
CCGGCCGTCTTCGGGCGGGACAGTCGCAAGGCGGTGCTGCAGGCCATTGGCGTCATCAGCTCCCAGCGGGCCTTT
ACCTTCCGTTCCCCCATCGAGAGCCTCTGGGCCGGCCGCGTCGGCGGCATCAAGCGGCTGGCGGATAAGAGCCGC
GAGTGGCGAGAGGAGGGAGGCGGCGAGGGCGGCATCATGGAGGAGGCT
Transcript >Ophio5|4387
ATGTTCAGTCGCGTTCGACGAAGCCAGCGGCAGCGCACCGGCGACGCGGGCCCGCCCTCCTTGGATCCTAAGAAA
GGCCCGAACTTGTCGACGGACCTGAGCCTAATCGTCGGCAATCCCAAGGGTCCTCCCCGTTCGAGACCCCTGGCC
AACCAGTCCGTCTTTCTCGAGAAGGGCAGTATCTATTCCGACGACTTGGCCAGCCTGCGTCGTGATTCCTTTGCG
AGTTCAGCTTCTTCCCCCGTCTTCGGCACCGCCCATCGGAGAGTCGGTGCCATCGATAATAACGTCATGGCGAGC
ACCGTTGAGCGCGCTCGCCATCGTCGCGAGCGCACATTTGTCGGCAGCGAATGCGCCTGTTGCGAGGAGCCCCTC
GAGCATACTCTGCAGGGCGAGCGCATCCTCCAGTTTTCCTGCTCCCACGTCTCCCACGAGGCCTGTTTCTACGAG
TTCATCCGCGAAGTCGACTCCCAACACTGCCCAACATGCGATGCTCCGCTGCATCTCGACACCAGCCGTGGCGGC
AATGTCATTGACATCAACAAAATTAGCAACATGATGCGCTCCACCGGCAGTGATTCCCGCTCCGCCAGCACGCCC
ACCCCGAGTTGGGACAACCAGACGGTGAGGTCGCCGAGCATCGGCAGCTCTCAAAAGAACCTCCCGGCCCTGCCG
TCAGGCGGCAATCGGAGGGAGATGGCGAGGGGCGGCAGCTTCAGAGACGGTCGCGAGCCTGCCCTGTCCGACCGC
TACGACTCCTCGAGACATACGCGCAGCGATAGCGAGGCCACCTACGTCGCCTCGTCGAGCGGATACACCGAAACG
TCACAGAGCGGCCTCTCCCGCCGTCACGACTACGACCTGCAGGCCATGGAGTCGTCACCGGGCAGCCCGCGTGCC
ATGTTCCGCAATCCGATCCCCGCCCCGACCGTCACGGTCCGATCCGAGTTTCCGTCCATCAACAGGTCTCGCCAA
CAGCAGACGCTCACCTGCCTCATCACCGTCGAGTCCGCTAGCAACAAATGGAGGCCTGACCTCGAGGACATTGGT
GTCCAGCCGCTGCAGCTGCCGTCGCTCGACGCTCGGATGGACGAGGGCATGGCGCGTTCAGCCGTCACGACGCCC
GCTCGCCCGTACCCTTACGAGTCTGCCGAGGTGCTGGAAGAGATGACGGAGCACCTGCGGAACCGCGTCGACAGC
TGGCACGGTCTGGATTTCGACAGTTTCGGACCCCTGCGCCTCTATGGCACGCTCCGAGTCGGCAAGAACAAGGTT
TCATGGCAGGTCCTGGAATGCTACCTCTTTGCTGAGATACTCATCTGCGTCAAGGAGAAGAAGCTGCCGGAACAT
TGGGACGACTACGGCAGCCCTCAGAGAGCGGCGACCCGCTGCACGCTCAAGGGCTCCATTCTCATCAAGAAGCAC
CTTAGCGAGGTGGTCGAGACCGGCACCATCGATGAGAATCTCCTGACTCTGACACTGACCGCGGGCGAGCTGCCC
CAGTTCCACCTCAAGTTTGACAACCGCAACCAGCTCAAGCTCTGGAACCAGGCGCTCCTGGACCTCATCATCGGC
GACGACTCTCCCGTCCGCATCCCTGACTACGACCACGGTGACACGTCCGAGACGGATGAGGAGATTGACTGGCAT
TGGTCGCGGTCCCATCGAGTCTCGTCGGCGGCCTCGTCATGGGGCCCCAAGTCGGCTACGACGGCACCGACGGAA
TATACGTCCTTTACCGCGAGGAGTCCCAGGCTGGGCAGCCCGATGCACGTGCCCATCGACGTCGTCGTCGTCGTA
CCCATCTCGTCGTCGATGCAGGGCGTCAAGATCAATCTGGTCCGCGACGCCCTCAAGTTCATGATTGGCAACCTC
GGCGAACGCGACCGGCTCGGCATCGTCACCTTCGGCTCGGCCAGCGGCGGCACGTCCATTGTCGGCATGATGACC
AAGTCGTACGCAGATTGGCCCAAGGTGCTGGCGTCCATCAAACCCGTGGGCCAGAAGAGCCCCCGGGCCGACGTG
GTCGAGGGCGCCAACGTGGCCATGAACCAGCTCATGCAGCGCAAGCACAGCAACCCCATCGCCACCATCATGCTC
ATCAGCGACGCGTCCACGGCCGACCCCGACTCGGTCGACTTCGTCGTCTCCCGCGCCGAGGCGGCCAAGATCACC
ATCCACTCGTTTGGCCTCGGCACGTCGCACAAGCCGGACACCATGATTGAGTTGTCGACGCGGACCAAGGCCTCG
TACACGTACGTCAAGGACTGGATGATGCTGCGCGAGTGCCTGGGCGGCTGCCTGGGTGGCCTACAGACGCTGTCG
CACCAAAATGTCAAGCTCATGCTCAAGCTTCCCGAGGGATCGCCGGCCAAGTTTCACAAGATTAGCGGCGCGCTG
CAGATCACCAAGCGCTCCGCGGGCCGCGACGCCGAGGCGAACCTCGGCGACCTGCGCTTCGGTGACAAGCGCGAC
GTGCTGGTTCAGCTCGTCATCACGCCCGACACCACGTCCCAGGAGCAGCTGCCGCAGGATCCGTGGGACAACATC
GTTTCCGGCCTCGAAGCCCTGGGCGGCTCCGTCGACCAAGAGGTAGAGCGTGCCATGTCGGTCGAGGAGGTTCCC
ATGATTCAGGCCGACCTCAGCTGGGGTGACATTTTGCGTGACGGCACCATGGGGAAAATGCCGAGGCCGTCTCTA
CTGACAGTTTCGATGCTGCCGGCCGTCGCCGGACAAAAGAAGCCGTGGGGGACGCCTCCGATCCCCCCGCACCCC
AGCATCGTCCAGCGGCGGATGGAGCTGCTGACGTCGGATATGTTGACGCGGGCCCTGACGCTCGTCAGCCGCGGC
CAGCACGACCGGGCGCACACGCTGCTCAACGAGACGCGATCGATCCTCAAGGGCCTCGGCAAGGGCGGCCTACCC
CCGGTGCCGCCGCCTCCGAACAGCAAGTCGGCCCCTTCGACGCCGCACCCGACGGGGGACGCGACGCCCAACGCG
GCAGGGACCCCGGACCGGAAGCGGAGCCCCTCCCCCCCCACGTCGGCCGCGTCGTCCGGCGGCAGCGGCAGCGGC
AGCGGAAGCGGAAGCGGCAACGGCTTCTCGGCCGGGCGGCTCGCCCGCAGCCGGTCCAACGACGGCTTCGGCCCC
GGCATAGGCATCGACCCGGGCACGGTGGCGGCGCTGGATGCGGAGCTGGAGAGCAGCCTCGAGTGGATCAACCAT
CCGGCCGTCTTCGGGCGGGACAGTCGCAAGGCGGTGCTGCAGGCCATTGGCGTCATCAGCTCCCAGCGGGCCTTT
ACCTTCCGTTCCCCCATCGAGAGCCTCTGGGCCGGCCGCGTCGGCGGCATCAAGCGGCTGGCGGATAAGAGCCGC
GAGTGGCGAGAGGAGGGAGGCGGCGAGGGCGGCATCATGGAGGAGGCTTGA
Gene >Ophio5|4387
ATGTTCAGTCGCGTTCGACGAAGCCAGCGGCAGCGCACCGGCGACGCGGGCCCGCCCTCCTTGGATCCTAAGAAA
GGCCCGAACTTGTCGACGGACCTGAGCCTAATCGTCGGCAATCCCAAGGGTCCTCCCCGTTCGAGACCCCTGGCC
AACCAGTCCGTCTTTCTCGAGAAGGGTAGGTCCTCCTTGAGCTTCTCGTCGCGCGAGCCGAGTCCGAGCCTCGCC
TTTGTTTCACTTGATCCTGCTTCCTAGTCGTCTCATATCCCGTGTCCTTTACTTGCATCTCTCTCCCGCTGACAA
CGCCATCCTTCATCCGCTCCAGGCAGTATCTATTCCGACGACTTGGCCAGCCTGCGTCGTGATTCCTTTGCGAGT
TCAGCTTCTTCCCCCGTCTTCGGCACCGCCCATCGGAGAGTCGGTGCCATCGATAATAACGTCATGGCGAGCACC
GTTGAGCGCGCTCGCCATCGTCGCGAGCGCACATTTGTCGGCAGCGAATGCGCCTGTTGCGAGGAGCCCCTCGAG
CATACTCTGCAGGGCGAGCGCATCCTCCAGTTTTCCTGCTCCCACGTCTCCCACGAGGCCTGTTTCTACGAGTTC
ATCCGCGAAGTCGACTCCCAACACTGCCCAACATGCGATGCTCCGCTGCATCTCGACACCAGCCGTGGCGGCAAT
GTCATTGACATCAGTCCGTTCCCTTCCACTTTGGTCCTGCGTCCGCCCGCTGACCTCGAGGCAGACAAAATTAGC
AACATGATGCGCTCCACCGGCAGTGATTCCCGCTCCGCCAGCACGCCCACCCCGAGTTGGGACAACCAGACGGTG
AGGTCGCCGAGCATCGGCAGCTCTCAAAAGAACCTCCCGGCCCTGCCGTCAGGCGGCAATCGGAGGGAGATGGCG
AGGGGCGGCAGCTTCAGAGACGGTCGCGAGCCTGCCCTGTCCGACCGCTACGACTCCTCGAGACATACGCGCAGC
GATAGCGAGGCCACCTACGTCGCCTCGTCGAGCGGATACACCGAAACGTCACAGAGCGGCCTCTCCCGCCGTCAC
GACTACGACCTGCAGGCCATGGAGTCGTCACCGGGCAGCCCGCGTGCCATGTTCCGCAATCCGATCCCCGCCCCG
ACCGTCACGGTCCGATCCGAGTTTCCGTCCATCAACAGGTCTCGCCAACAGCAGACGCTCACCTGCCTCATCACC
GTCGAGTCCGCTAGCAACAAATGGAGGCCTGACCTCGAGGACATTGGTGTCCAGCCGCTGCAGCTGCCGTCGCTC
GACGCTCGGATGGACGAGGGCATGGCGCGTTCAGCCGTCACGACGCCCGCTCGCCCGTACCCTTACGAGTCTGCC
GAGGTGCTGGAAGAGATGACGGAGCACCTGCGGAACCGCGTCGACAGCTGGCACGGTCTGGATTTCGACAGGTAA
GCCTTTGCCTAGGCCATCTTCCTGTTCCTCGTAACTGACATGTCCCAGTTTCGGACCCCTGCGCCTCTATGGCAC
GCTCCGAGTCGGCAAGAACAAGGTTTCATGGCAGGTCCTGGAATGCTACCTCTTTGCTGAGATACTCATCTGCGT
CAAGGAGAAGAAGCTGCCGGAACATTGGGACGACTACGGCAGCCCTCAGAGAGCGGCGACCCGCTGCACGCTCAA
GGGCTCCATTCTCATCAAGAAGCACCTTAGCGAGGTGGTCGAGACCGGCACCATCGATGAGAATCTCCTGACTCT
GACACTGACCGCGGGCGAGCTGCCCCAGTTCCACCTCAAGTTTGACAACCGCAACCAGCTCAAGCTCTGGAACCA
GGCGCTCCTGGACCTCATCATCGGCGACGACTCTCCCGTCCGCATCCCTGACTACGACCACGGTGACACGTCCGA
GACGGATGAGGAGATTGACTGGCATTGGTCGCGGTCCCATCGAGTCTCGTCGGCGGCCTCGTCATGGGGCCCCAA
GTCGGCTACGACGGCACCGACGGAATATACGTCCTTTACCGCGAGGAGTCCCAGGCTGGGCAGCCCGATGCACGT
GCCCATCGACGTCGTCGTCGTCGTACCCATCTCGTCGTCGATGCAGGGCGTCAAGATCAATCTGGTCCGCGACGC
CCTCAAGTTCATGATTGGCAACCTCGGCGAACGCGACCGGCTCGGCATCGTCACCTTCGGCTCGGCCAGCGGCGG
CACGTCCATTGTCGGCATGATGACCAAGTCGTACGCAGATTGGCCCAAGGTGCTGGCGTCCATCAAACCCGTGGG
CCAGAAGAGCCCCCGGGCCGACGTGGTCGAGGGCGCCAACGTGGCCATGAACCAGCTCATGCAGCGCAAGCACAG
CAACCCCATCGCCACCATCATGCTCATCAGCGACGCGTCCACGGCCGACCCCGACTCGGTCGACTTCGTCGTCTC
CCGCGCCGAGGCGGCCAAGATCACCATCCACTCGTTTGGCCTCGGCACGTCGCACAAGCCGGACACCATGATTGA
GTTGTCGACGCGGACCAAGGCCTCGTACACGTACGTCAAGGACTGGATGATGCTGCGCGAGTGCCTGGGCGGCTG
CCTGGGTGGCCTACAGACGCTGTCGCACCAAAATGTCAAGCTCATGCTCAAGCTTCCCGAGGGATCGCCGGCCAA
GTTTCACAAGATTAGCGGCGCGCTGCAGATCACCAAGCGCTCCGCGGGCCGCGACGCCGAGGCGAACCTCGGCGA
CCTGCGCTTCGGTGACAAGCGCGACGTGCTGGTTCAGCTCGTCATCACGCCCGACACCACGTCCCAGGAGCAGCT
GCCGCAGGATCCGTGGGACAACATCGTTTCCGGCCTCGAAGCCCTGGGCGGCTCCGTCGACCAAGAGGTAGAGCG
TGCCATGTCGGTCGAGGAGGTTCCCATGATTCAGGCCGACCTCAGCTGGGGTGACATTTTGCGTGACGGCACCAT
GGGGAAAATGCCGAGGCCGTCTCTACTGACAGTTTCGATGCTGCCGGCCGTCGCCGGACAAAAGAAGCCGTGGGG
GACGCCTCCGATCCCCCCGCACCCCAGCATCGTCCAGCGGCGGATGGAGCTGCTGACGTCGGATATGTTGACGCG
GGCCCTGACGCTCGTCAGCCGCGGCCAGCACGACCGGGCGCACACGCTGCTCAACGAGACGCGATCGATCCTCAA
GGGCCTCGGCAAGGGCGGCCTACCCCCGGTGCCGCCGCCTCCGAACAGCAAGTCGGCCCCTTCGACGCCGCACCC
GACGGGGGACGCGACGCCCAACGCGGCAGGGACCCCGGACCGGAAGCGGAGCCCCTCCCCCCCCACGTCGGCCGC
GTCGTCCGGCGGCAGCGGCAGCGGCAGCGGAAGCGGAAGCGGCAACGGCTTCTCGGCCGGGCGGCTCGCCCGCAG
CCGGTCCAACGACGGCTTCGGCCCCGGCATAGGCATCGACCCGGGCACGGTGGCGGCGCTGGATGCGGAGCTGGA
GAGCAGCCTCGAGTGGATCAACCATCCGGCCGTCTTCGGGCGGGACAGTCGCAAGGCGGTGCTGCAGGCCATTGG
CGTCATCAGCTCCCAGCGGGCCTTTACCTTCCGTTCCCCCATCGAGAGCCTCTGGGCCGGCCGCGTCGGCGGCAT
CAAGCGGCTGGCGGATAAGAGCCGCGAGTGGCGAGAGGAGGGAGGCGGCGAGGGCGGCATCATGGAGGAGGCTTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail