Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4373
Gene name
Locationscaffold_347:3724..5782
Strand+
Gene length (bp)2058
Transcript length (bp)1581
Coding sequence length (bp)1578
Protein length (aa) 526

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01207 Dus Dihydrouridine synthase (Dus) 7.4E-36 189 474

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O95620|DUS4L_HUMAN tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like OS=Homo sapiens GN=DUS4L PE=2 SV=2 172 513 9.0E-58
sp|Q32M08|DUS4L_MOUSE tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like OS=Mus musculus GN=Dus4l PE=2 SV=1 172 516 3.0E-57
sp|Q06063|DUS4_YEAST tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUS4 PE=1 SV=1 156 510 4.0E-53
sp|O74553|DUS4_SCHPO tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus4 PE=3 SV=1 172 497 4.0E-53
sp|Q09504|YQI2_CAEEL Uncharacterized tRNA-dihydrouridine synthase-like protein C45G9.2 OS=Caenorhabditis elegans GN=C45G9.2 PE=3 SV=2 192 504 3.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O95620|DUS4L_HUMAN tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like OS=Homo sapiens GN=DUS4L PE=2 SV=2 172 513 9.0E-58
sp|Q32M08|DUS4L_MOUSE tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+]-like OS=Mus musculus GN=Dus4l PE=2 SV=1 172 516 3.0E-57
sp|Q06063|DUS4_YEAST tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUS4 PE=1 SV=1 156 510 4.0E-53
sp|O74553|DUS4_SCHPO tRNA-dihydrouridine(20a/20b) synthase [NAD(P)+] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus4 PE=3 SV=1 172 497 4.0E-53
sp|Q09504|YQI2_CAEEL Uncharacterized tRNA-dihydrouridine synthase-like protein C45G9.2 OS=Caenorhabditis elegans GN=C45G9.2 PE=3 SV=2 192 504 3.0E-41
sp|Q6P1R4|DUS1L_HUMAN tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Homo sapiens GN=DUS1L PE=1 SV=1 187 523 2.0E-28
sp|Q8C2P3|DUS1L_MOUSE tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Mus musculus GN=Dus1l PE=2 SV=1 187 518 2.0E-27
sp|Q8K582|DUS1L_RAT tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Rattus norvegicus GN=Dus1l PE=2 SV=1 187 518 6.0E-27
sp|Q9HGN6|DUS1_SCHPO tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus1 PE=3 SV=1 190 439 3.0E-18
sp|P53759|DUS1_YEAST tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUS1 PE=1 SV=1 174 439 3.0E-14
sp|O74731|DUS2_SCHPO tRNA-dihydrouridine(20) synthase [NAD(P)+] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dus2 PE=3 SV=1 190 402 3.0E-09
sp|Q9NX74|DUS2L_HUMAN tRNA-dihydrouridine(20) synthase [NAD(P)+]-like OS=Homo sapiens GN=DUS2 PE=1 SV=1 190 450 4.0E-07
sp|O67533|DUS_AQUAE Probable tRNA-dihydrouridine synthase OS=Aquifex aeolicus (strain VF5) GN=dus PE=3 SV=1 190 443 2.0E-06
sp|Q9D7B1|DUS2L_MOUSE tRNA-dihydrouridine(20) synthase [NAD(P)+]-like OS=Mus musculus GN=Dus2 PE=1 SV=1 190 450 2.0E-06
sp|P53720|DUS2_YEAST tRNA-dihydrouridine(20) synthase [NAD(P)+] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMM1 PE=1 SV=1 190 400 6.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.7342 0.5265 0.1629 0.058 0.4935 0.0435 0.119 0.0895 0.0939 0.0215

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1452
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2868
Ophiocordyceps australis map64 (Brazil) OphauB2|2255
Ophiocordyceps camponoti-floridani Ophcf2|05114
Ophiocordyceps camponoti-rufipedis Ophun1|7510
Ophiocordyceps kimflemingae Ophio5|4373 (this protein)
Ophiocordyceps subramaniannii Hirsu2|11

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4373
MWASTAVEKGYHVPDDPGRACQPLRVDPQAMPAFFRLIRFLGRDNRIYYGDALLPPGVDDIAAATQARIGQGDIF
DHAREPIDLFRPVFSSSRLLWPVPPPDVAAHVPSSGSIPRAETSPISAANEKTRRRQSYTHPPPHVVLTTWHSAF
AQKQTTMDPPTEDGPSPTATHPLKLFDAARQQDRFLYACAPMVRYSKLAFRQTVHKYGVDLCWTPMVLAKEFNRN
DVARDSDLTVSTRGPQPPTILQFGANSALELSRAASLAAPFVSGVDLNCGCPQSWACAETLGAALMDRRELVRDM
VVDTRQRLARDGWAVGLDADMESSRGRSVSVKIRVHSDLRKTMDFLDTVIGHPQSRLVDWITIHPRTRHTPSTTP
IRTDALEILTTKYASTLPILLSGDVFALSCLPFDGPSDADPRPSNTRISGFMSARGLLANPALFAGYSACPWEAL
ETFMCNVARCPLPFKLVAHHVTQMCGPGMGADKSALLPKKERAKLADLDNMLDLVDFLDSKIGEQTGRAGGLRRD
L
Coding >Ophio5|4373
ATGTGGGCGTCGACCGCGGTGGAAAAGGGGTATCATGTTCCCGACGATCCTGGCCGAGCATGCCAGCCTCTACGT
GTCGATCCTCAAGCAATGCCCGCCTTCTTCCGCCTTATCCGCTTTCTCGGCCGAGACAACCGCATATACTACGGC
GATGCCCTCCTCCCGCCCGGCGTCGACGACATTGCCGCAGCGACGCAGGCGCGCATCGGCCAAGGCGACATATTC
GACCACGCCCGCGAGCCCATTGATCTCTTCCGACCTGTCTTTTCGTCTAGTCGATTGCTCTGGCCGGTTCCCCCT
CCGGATGTCGCTGCCCACGTGCCGTCGAGTGGGTCGATACCGAGGGCCGAGACAAGTCCGATATCGGCAGCCAAC
GAGAAAACCCGTCGACGTCAAAGCTACACCCACCCACCACCACACGTCGTGCTCACGACTTGGCACTCAGCTTTC
GCTCAGAAGCAGACGACAATGGATCCTCCGACCGAGGACGGCCCTTCGCCGACCGCGACGCACCCCCTAAAACTC
TTCGATGCAGCTAGGCAACAGGACCGGTTCTTATACGCGTGCGCGCCCATGGTGCGCTACAGCAAGCTTGCCTTC
CGCCAGACAGTCCACAAGTACGGCGTCGACCTCTGCTGGACACCAATGGTACTGGCCAAGGAGTTCAACCGAAAC
GACGTCGCCCGAGATAGCGACCTCACCGTCTCAACTCGAGGCCCCCAGCCGCCCACCATCCTCCAGTTCGGTGCA
AACTCTGCCCTCGAGCTCTCCCGTGCCGCCTCTCTTGCCGCCCCCTTCGTCTCCGGCGTCGATCTCAACTGCGGC
TGTCCCCAGTCGTGGGCCTGTGCCGAGACGCTCGGTGCCGCACTCATGGACCGCCGCGAGCTTGTCCGCGACATG
GTCGTCGATACTCGTCAGCGCCTCGCCCGCGATGGATGGGCTGTCGGCCTGGATGCAGACATGGAGAGCTCTCGA
GGCCGTAGTGTCAGCGTCAAGATCAGAGTGCACAGCGATCTGCGTAAAACAATGGATTTCCTGGACACGGTTATA
GGACATCCGCAGAGTCGCCTCGTCGACTGGATCACCATCCATCCACGAACAAGGCACACCCCGTCCACGACCCCC
ATCCGAACCGACGCCCTCGAAATCCTCACTACCAAGTACGCCAGCACGCTTCCCATCCTCCTCTCCGGCGACGTT
TTCGCTCTCTCGTGCCTGCCCTTCGACGGCCCGTCCGACGCCGACCCTCGACCCAGCAACACCCGCATCAGCGGC
TTCATGTCGGCGCGCGGCCTGCTCGCTAACCCGGCCCTCTTCGCCGGATATTCGGCCTGTCCGTGGGAGGCCCTG
GAGACCTTCATGTGCAACGTCGCCCGCTGCCCGCTGCCCTTCAAGCTCGTCGCCCACCACGTCACGCAGATGTGC
GGGCCCGGCATGGGCGCCGACAAGTCGGCACTGCTGCCCAAGAAGGAGAGGGCCAAGCTCGCCGATCTGGACAAC
ATGCTCGACCTGGTGGACTTCCTGGACAGTAAGATAGGGGAGCAAACCGGCAGGGCAGGCGGCCTTCGGCGAGAT
CTG
Transcript >Ophio5|4373
ATGTGGGCGTCGACCGCGGTGGAAAAGGGGTATCATGTTCCCGACGATCCTGGCCGAGCATGCCAGCCTCTACGT
GTCGATCCTCAAGCAATGCCCGCCTTCTTCCGCCTTATCCGCTTTCTCGGCCGAGACAACCGCATATACTACGGC
GATGCCCTCCTCCCGCCCGGCGTCGACGACATTGCCGCAGCGACGCAGGCGCGCATCGGCCAAGGCGACATATTC
GACCACGCCCGCGAGCCCATTGATCTCTTCCGACCTGTCTTTTCGTCTAGTCGATTGCTCTGGCCGGTTCCCCCT
CCGGATGTCGCTGCCCACGTGCCGTCGAGTGGGTCGATACCGAGGGCCGAGACAAGTCCGATATCGGCAGCCAAC
GAGAAAACCCGTCGACGTCAAAGCTACACCCACCCACCACCACACGTCGTGCTCACGACTTGGCACTCAGCTTTC
GCTCAGAAGCAGACGACAATGGATCCTCCGACCGAGGACGGCCCTTCGCCGACCGCGACGCACCCCCTAAAACTC
TTCGATGCAGCTAGGCAACAGGACCGGTTCTTATACGCGTGCGCGCCCATGGTGCGCTACAGCAAGCTTGCCTTC
CGCCAGACAGTCCACAAGTACGGCGTCGACCTCTGCTGGACACCAATGGTACTGGCCAAGGAGTTCAACCGAAAC
GACGTCGCCCGAGATAGCGACCTCACCGTCTCAACTCGAGGCCCCCAGCCGCCCACCATCCTCCAGTTCGGTGCA
AACTCTGCCCTCGAGCTCTCCCGTGCCGCCTCTCTTGCCGCCCCCTTCGTCTCCGGCGTCGATCTCAACTGCGGC
TGTCCCCAGTCGTGGGCCTGTGCCGAGACGCTCGGTGCCGCACTCATGGACCGCCGCGAGCTTGTCCGCGACATG
GTCGTCGATACTCGTCAGCGCCTCGCCCGCGATGGATGGGCTGTCGGCCTGGATGCAGACATGGAGAGCTCTCGA
GGCCGTAGTGTCAGCGTCAAGATCAGAGTGCACAGCGATCTGCGTAAAACAATGGATTTCCTGGACACGGTTATA
GGACATCCGCAGAGTCGCCTCGTCGACTGGATCACCATCCATCCACGAACAAGGCACACCCCGTCCACGACCCCC
ATCCGAACCGACGCCCTCGAAATCCTCACTACCAAGTACGCCAGCACGCTTCCCATCCTCCTCTCCGGCGACGTT
TTCGCTCTCTCGTGCCTGCCCTTCGACGGCCCGTCCGACGCCGACCCTCGACCCAGCAACACCCGCATCAGCGGC
TTCATGTCGGCGCGCGGCCTGCTCGCTAACCCGGCCCTCTTCGCCGGATATTCGGCCTGTCCGTGGGAGGCCCTG
GAGACCTTCATGTGCAACGTCGCCCGCTGCCCGCTGCCCTTCAAGCTCGTCGCCCACCACGTCACGCAGATGTGC
GGGCCCGGCATGGGCGCCGACAAGTCGGCACTGCTGCCCAAGAAGGAGAGGGCCAAGCTCGCCGATCTGGACAAC
ATGCTCGACCTGGTGGACTTCCTGGACAGTAAGATAGGGGAGCAAACCGGCAGGGCAGGCGGCCTTCGGCGAGAT
CTGTGA
Gene >Ophio5|4373
ATGTGGGCGTCGACCGCGGTGGAAAAGGGGTATCATGTGTGAGTCTCGATACTACTGTCTCGACACACTGTACGG
CACAGTCCCGACGATCCTGGCCGAGCATGCCAGCCTCTACGTGTCGATCCTCAAGCAATGCCCGCCTTCTTCGTG
AACATCGACGAACCTCCCCCCTTTTTTTCCTCTGGCTCCCCAGCACCGCACCTGACGCGGCCTCATAGCGCCTTA
TCCGCTTTCTCGGCCGAGACAACCGCATATACTACGGCGATGCCCTCCTCCCGCCCGGCGTCGACGACATTGCCG
CAGCGACGCAGGCGCGCATCGGCCAAGGCGACATATTCGGTAAACCCTCGATCGGGGATCGGGACGTCGACATTC
GACGCTTGCCGCCACTGTGCGGTGCCTGGGCCTCAACTACGCAGACCACGCCCGCGAGCCCATTGATCTCTTCCG
ACCTGTCTTTTCGTCTAGTCGATTGCTCTGGCCGGTTCCCCCTCCGGATGTCGCTGCCCACGTGCCGTCGAGTGG
GTCGATACCGAGGGCCGAGACAAGTCCGATATCGGCAGCCAACGAGAAAACCCGTCGACGTCAAAGCTACACCCA
CCCACCACCACACGTCGTGCTCACGACTTGGCACTCAGCTTTCGCTCAGAAGCAGACGACAATGGATCCTCCGAC
CGAGGACGGCCCTTCGCCGACCGCGACGCAGTAAGCGCCCAAGCGAAGAGAGGGAAAAAAATAATTGCGAAGCAA
TATCTCCACCACTGACAGCGCCGGCGCAAACAGCCCCCTAAAACTCTTCGATGCAGCTAGGCAACAGGACCGGTT
CTTATACGCGTGCGCGCCCATGGTGCGCTACAGCAAGGCATGTCGCCTCGTCTTCCCCTGCCGTAAATCTGACCC
AAAGGAGCTCACATGACCCCCCCCCCCCCCTCCGTTCCGCAGCTTGCCTTCCGCCAGACAGTCCACAAGTACGGC
GTCGACCTCTGCTGGACACCAATGGTACTGGCCAAGGAGTTCAACCGAAACGACGTCGCCCGAGATAGCGGTGCG
TGCCATTCTGCTCTTCGACCTACACGGGCAAGAAAAGAAACATGGTTGTTGATGATGGTCAAGACCTCACCGTCT
CAACTCGAGGCCCCCAGCCGCCCACCATCCTCCAGTTCGGTGCAAACTCTGCCCTCGAGCTCTCCCGTGCCGCCT
CTCTTGCCGCCCCCTTCGTCTCCGGCGTCGATCTCAACTGCGGCTGTCCCCAGTCGTGGGCCTGTGCCGAGACGC
TCGGTGCCGCACTCATGGACCGCCGCGAGCTTGTCCGCGACATGGTCGTCGATACTCGTCAGCGCCTCGCCCGCG
ATGGATGGGCTGTCGGCCTGGATGCAGACATGGAGAGCTCTCGAGGCCGTAGTGTCAGCGTCAAGATCAGAGTGC
ACAGCGATCTGCGGTGCGTAGACATCTTCATGCTCTCTCTCTCTCTGTGTTCATGATTGACCTCGGGGCAGTAAA
ACAATGGATTTCCTGGACACGGTTATAGGACATCCGCAGAGTCGCCTCGTCGACTGGATCACCATCCATCCACGA
ACAAGGCACACCCCGTCCACGACCCCCATCCGAACCGACGCCCTCGAAATCCTCACTACCAAGTACGCCAGCACG
CTTCCCATCCTCCTCTCCGGCGACGTTTTCGCTCTCTCGTGCCTGCCCTTCGACGGCCCGTCCGACGCCGACCCT
CGACCCAGCAACACCCGCATCAGCGGCTTCATGTCGGCGCGCGGCCTGCTCGCTAACCCGGCCCTCTTCGCCGGA
TATTCGGCCTGTCCGTGGGAGGCCCTGGAGACCTTCATGTGCAACGTCGCCCGCTGCCCGCTGCCCTTCAAGCTC
GTCGCCCACCACGTCACGCAGATGTGCGGGCCCGGCATGGGCGCCGACAAGTCGGCACTGCTGCCCAAGAAGGAG
AGGGCCAAGCTCGCCGATCTGGACAACATGCTCGACCTGGTGGACTTCCTGGACAGTAAGATAGGGGAGCAAACC
GGCAGGGCAGGCGGCCTTCGGCGAGATCTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail