Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4372
Gene name
Locationscaffold_347:681..3614
Strand-
Gene length (bp)2933
Transcript length (bp)2619
Coding sequence length (bp)2616
Protein length (aa) 872

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05347 Complex1_LYR Complex 1 protein (LYR family) 7.3E-16 8 66
PF13233 Complex1_LYR_2 Complex1_LYR-like 8.7E-05 10 56

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US02|SDHF1_SCHPO Succinate dehydrogenase assembly factor 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC664.12c PE=3 SV=1 1 76 3.0E-13
sp|Q3E785|SDHF1_YEAST Succinate dehydrogenase assembly factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH6 PE=1 SV=1 2 76 2.0E-11
sp|A6ZYX9|SDHF1_YEAS7 Succinate dehydrogenase assembly factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_1267 PE=3 SV=1 2 76 2.0E-11
sp|B0K036|SDHF1_RAT Succinate dehydrogenase assembly factor 1, mitochondrial OS=Rattus norvegicus GN=Sdhaf1 PE=3 SV=1 2 83 3.0E-10
sp|A6NFY7|SDHF1_HUMAN Succinate dehydrogenase assembly factor 1, mitochondrial OS=Homo sapiens GN=SDHAF1 PE=1 SV=1 2 106 3.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9US02|SDHF1_SCHPO Succinate dehydrogenase assembly factor 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC664.12c PE=3 SV=1 1 76 3.0E-13
sp|Q3E785|SDHF1_YEAST Succinate dehydrogenase assembly factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SDH6 PE=1 SV=1 2 76 2.0E-11
sp|A6ZYX9|SDHF1_YEAS7 Succinate dehydrogenase assembly factor 1, mitochondrial OS=Saccharomyces cerevisiae (strain YJM789) GN=SCY_1267 PE=3 SV=1 2 76 2.0E-11
sp|B0K036|SDHF1_RAT Succinate dehydrogenase assembly factor 1, mitochondrial OS=Rattus norvegicus GN=Sdhaf1 PE=3 SV=1 2 83 3.0E-10
sp|A6NFY7|SDHF1_HUMAN Succinate dehydrogenase assembly factor 1, mitochondrial OS=Homo sapiens GN=SDHAF1 PE=1 SV=1 2 106 3.0E-09
sp|Q3U276|SDHF1_MOUSE Succinate dehydrogenase assembly factor 1, mitochondrial OS=Mus musculus GN=Sdhaf1 PE=1 SV=1 6 83 8.0E-09
sp|A8PU71|SDHF1_BOVIN Succinate dehydrogenase assembly factor 1, mitochondrial OS=Bos taurus GN=SDHAF1 PE=3 SV=1 2 80 3.0E-08
sp|Q54HG5|SDHFA_DICDI Succinate dehydrogenase assembly factor 1A, mitochondrial OS=Dictyostelium discoideum GN=sdhaf1A PE=3 SV=1 1 79 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4372
MRLSGLQKDVLCLYRQCLRASRRKPEDTRSHFESFVRAEFTRHMSIDKRDFDTIEFLLRKGRRQLQVYAAPDIKD
LFQFLAPQLAAVCFPRRRSPPVSPPKHDASGPLMISQFKSTLSCHYSVTNIKMATLASIPEASTLLPNTHDSRPL
QRTASFERIRPRSRVLILSRRPTRVRNPARRAPVAAAPRQASGQRHPPAEVSCRASSHLEASDVTPGDAPKAPQR
SHSRPPYHRFDSASPTDQALETSVSSVDLDSFPLPPSHRGLAKRSSPNPQAGPNRDGAISPTRDGPFSSARRCFG
EVAADVARASKHSSIDSTLVEAISRTIAQQFRLLSVAKYADRELIHPSRSSFSPSFAHASRPEKPRRRDSLDRFT
ADLYKYAYNTGPRDEAEQSSPDPPRSGESLHTVSALMPFRPEFRAAGLAVTSKDQAERSPGYLSRAYASLRSRQL
LSKAPRNRNLHASQIDGPGEVPSSSTNTEISFAPSQADEWRSALIEEVPVRKKKRGKKAKRQRKSCFPCFRGKEK
PAADGDWAHFREAPEKPAADRHAAWESRPTRPRLPPILQTAETRPSRFDSVPRSPKHVSIPQPMIKRKDINALPK
SVARPRGQATKDKQPTTLPTNLAPFKTQSGAFPRRDGDKRRKPGSRREPVILSSKTDRQASGRETGRVPSKAKAG
DMPEEDHGHALSALPSTWFRQDGPIPDLEEELEKTARLVANTKPSATSRRPTTSTRRQKQPTLRYDPNHMGICCR
SSRGLPSRATAPPNIPMRTSSVKGSVSSDADDEGIKDGDVLRGLHVAASAACDQEVDAFVRDQTGLRIRRFLADL
MTLEAFGHPLPGEGSEQRAWRRRAEMRPLKRRVRRSRELSGVAGGFI
Coding >Ophio5|4372
ATGCGTCTCTCCGGCCTCCAGAAAGACGTGCTATGCTTGTACCGCCAATGCCTCCGCGCCAGCCGCAGGAAGCCC
GAGGACACCCGCTCTCACTTCGAGTCCTTCGTCAGGGCCGAGTTTACTCGCCACATGAGCATCGACAAGCGCGAC
TTTGACACGATCGAGTTCCTACTGCGCAAAGGCCGAAGACAGCTACAGGTGTACGCTGCTCCCGACATCAAAGAT
CTCTTCCAGTTCTTAGCTCCCCAGCTTGCCGCTGTCTGCTTTCCTCGGCGCCGCTCACCTCCAGTCTCTCCTCCC
AAGCACGACGCGTCTGGACCACTGATGATTTCCCAGTTCAAGTCCACCTTGTCCTGTCATTACTCTGTCACCAAC
ATCAAGATGGCTACTCTAGCATCAATTCCAGAGGCAAGCACTTTGTTGCCCAACACGCACGACTCCCGACCGCTT
CAGCGGACTGCTTCCTTTGAGAGAATTCGGCCGCGATCTCGTGTCTTGATACTCTCCAGACGCCCAACCCGTGTC
CGCAACCCGGCTCGGCGTGCGCCAGTCGCGGCGGCGCCGCGTCAAGCAAGTGGTCAGAGACATCCGCCTGCAGAG
GTTTCCTGCCGAGCGAGCTCTCACTTGGAGGCGAGCGACGTGACTCCAGGTGACGCTCCAAAGGCACCGCAAAGA
AGCCACAGCCGGCCGCCATACCACCGGTTCGATTCGGCCTCACCAACCGACCAGGCGCTGGAGACTTCTGTCTCT
TCCGTCGACTTGGACTCGTTCCCTCTTCCGCCCTCGCATCGCGGGCTTGCGAAAAGGTCTTCGCCGAACCCTCAG
GCGGGGCCAAATCGGGATGGTGCCATTTCGCCCACCAGGGATGGGCCTTTCTCGAGTGCGCGGCGGTGCTTTGGC
GAGGTTGCCGCCGATGTTGCCAGAGCCTCGAAGCACTCGTCCATAGATTCTACTCTCGTCGAAGCCATCTCAAGA
ACCATCGCTCAGCAGTTCCGCCTCCTCTCCGTCGCCAAGTACGCCGACCGGGAATTGATTCATCCATCAAGATCC
AGCTTCTCACCTTCATTTGCCCATGCCAGCCGACCTGAAAAACCAAGACGTCGGGATTCCCTTGATCGTTTTACC
GCTGACCTCTACAAATACGCATACAACACTGGGCCCAGGGATGAAGCTGAGCAATCGTCACCCGATCCTCCCAGG
TCTGGGGAGAGCCTTCACACAGTGTCTGCCCTGATGCCCTTCCGTCCAGAGTTTAGGGCGGCAGGGCTCGCCGTG
ACATCCAAGGATCAAGCCGAACGCAGTCCTGGCTACTTGTCGAGAGCATACGCGTCGCTGCGGTCACGTCAACTT
CTATCCAAAGCCCCTCGAAACAGGAATCTGCACGCGTCTCAAATCGACGGGCCAGGGGAGGTCCCGAGCTCCAGC
ACAAACACTGAGATCTCCTTCGCTCCGAGCCAGGCGGACGAATGGAGAAGTGCCCTGATCGAAGAGGTGCCGGTG
CGGAAAAAGAAGCGAGGCAAAAAGGCAAAAAGGCAAAGAAAGTCTTGTTTTCCGTGTTTTCGTGGCAAGGAAAAG
CCCGCCGCCGACGGAGATTGGGCACACTTCAGAGAAGCCCCGGAGAAGCCAGCTGCAGACCGCCATGCCGCGTGG
GAATCAAGGCCGACAAGGCCCAGACTGCCGCCCATCCTCCAGACGGCAGAAACTCGACCCTCGCGTTTTGACTCT
GTCCCCCGAAGCCCTAAACATGTGTCGATACCACAGCCGATGATCAAAAGAAAGGATATAAACGCTCTGCCTAAG
TCTGTGGCGCGGCCGCGAGGGCAGGCGACCAAGGACAAGCAACCGACGACCCTGCCCACGAATTTGGCGCCTTTC
AAGACTCAATCCGGCGCATTTCCGCGCCGAGATGGCGACAAGAGACGCAAGCCGGGTTCCAGAAGAGAGCCAGTG
ATTTTGTCGTCGAAGACTGATCGGCAAGCGTCTGGCCGTGAGACGGGCCGAGTTCCCTCCAAGGCGAAGGCGGGC
GATATGCCGGAAGAGGATCACGGTCACGCCTTGTCGGCGTTGCCTTCGACTTGGTTCCGCCAGGATGGTCCCATC
CCGGACCTGGAGGAGGAGCTCGAAAAGACGGCACGACTAGTTGCAAATACTAAACCTTCAGCCACAAGCAGACGA
CCGACGACGTCGACTCGGCGGCAGAAGCAGCCGACGCTCCGCTACGACCCAAACCACATGGGCATATGCTGCCGC
AGCAGCAGGGGGCTCCCTTCCCGGGCCACGGCCCCGCCCAATATCCCCATGAGAACCTCATCCGTCAAGGGCAGT
GTCAGCTCCGACGCGGACGACGAGGGCATCAAAGACGGCGACGTCTTGCGCGGGTTGCACGTGGCGGCTTCGGCT
GCTTGCGACCAGGAAGTGGATGCCTTCGTGCGCGACCAGACGGGGCTGCGGATCCGCCGCTTCCTGGCCGACTTG
ATGACGCTTGAAGCCTTTGGTCATCCGCTGCCGGGGGAGGGCAGCGAGCAGCGGGCGTGGCGGAGGAGGGCGGAG
ATGAGGCCGCTGAAGCGACGTGTCCGCCGTTCGCGCGAGCTGTCGGGCGTCGCTGGGGGGTTCATC
Transcript >Ophio5|4372
ATGCGTCTCTCCGGCCTCCAGAAAGACGTGCTATGCTTGTACCGCCAATGCCTCCGCGCCAGCCGCAGGAAGCCC
GAGGACACCCGCTCTCACTTCGAGTCCTTCGTCAGGGCCGAGTTTACTCGCCACATGAGCATCGACAAGCGCGAC
TTTGACACGATCGAGTTCCTACTGCGCAAAGGCCGAAGACAGCTACAGGTGTACGCTGCTCCCGACATCAAAGAT
CTCTTCCAGTTCTTAGCTCCCCAGCTTGCCGCTGTCTGCTTTCCTCGGCGCCGCTCACCTCCAGTCTCTCCTCCC
AAGCACGACGCGTCTGGACCACTGATGATTTCCCAGTTCAAGTCCACCTTGTCCTGTCATTACTCTGTCACCAAC
ATCAAGATGGCTACTCTAGCATCAATTCCAGAGGCAAGCACTTTGTTGCCCAACACGCACGACTCCCGACCGCTT
CAGCGGACTGCTTCCTTTGAGAGAATTCGGCCGCGATCTCGTGTCTTGATACTCTCCAGACGCCCAACCCGTGTC
CGCAACCCGGCTCGGCGTGCGCCAGTCGCGGCGGCGCCGCGTCAAGCAAGTGGTCAGAGACATCCGCCTGCAGAG
GTTTCCTGCCGAGCGAGCTCTCACTTGGAGGCGAGCGACGTGACTCCAGGTGACGCTCCAAAGGCACCGCAAAGA
AGCCACAGCCGGCCGCCATACCACCGGTTCGATTCGGCCTCACCAACCGACCAGGCGCTGGAGACTTCTGTCTCT
TCCGTCGACTTGGACTCGTTCCCTCTTCCGCCCTCGCATCGCGGGCTTGCGAAAAGGTCTTCGCCGAACCCTCAG
GCGGGGCCAAATCGGGATGGTGCCATTTCGCCCACCAGGGATGGGCCTTTCTCGAGTGCGCGGCGGTGCTTTGGC
GAGGTTGCCGCCGATGTTGCCAGAGCCTCGAAGCACTCGTCCATAGATTCTACTCTCGTCGAAGCCATCTCAAGA
ACCATCGCTCAGCAGTTCCGCCTCCTCTCCGTCGCCAAGTACGCCGACCGGGAATTGATTCATCCATCAAGATCC
AGCTTCTCACCTTCATTTGCCCATGCCAGCCGACCTGAAAAACCAAGACGTCGGGATTCCCTTGATCGTTTTACC
GCTGACCTCTACAAATACGCATACAACACTGGGCCCAGGGATGAAGCTGAGCAATCGTCACCCGATCCTCCCAGG
TCTGGGGAGAGCCTTCACACAGTGTCTGCCCTGATGCCCTTCCGTCCAGAGTTTAGGGCGGCAGGGCTCGCCGTG
ACATCCAAGGATCAAGCCGAACGCAGTCCTGGCTACTTGTCGAGAGCATACGCGTCGCTGCGGTCACGTCAACTT
CTATCCAAAGCCCCTCGAAACAGGAATCTGCACGCGTCTCAAATCGACGGGCCAGGGGAGGTCCCGAGCTCCAGC
ACAAACACTGAGATCTCCTTCGCTCCGAGCCAGGCGGACGAATGGAGAAGTGCCCTGATCGAAGAGGTGCCGGTG
CGGAAAAAGAAGCGAGGCAAAAAGGCAAAAAGGCAAAGAAAGTCTTGTTTTCCGTGTTTTCGTGGCAAGGAAAAG
CCCGCCGCCGACGGAGATTGGGCACACTTCAGAGAAGCCCCGGAGAAGCCAGCTGCAGACCGCCATGCCGCGTGG
GAATCAAGGCCGACAAGGCCCAGACTGCCGCCCATCCTCCAGACGGCAGAAACTCGACCCTCGCGTTTTGACTCT
GTCCCCCGAAGCCCTAAACATGTGTCGATACCACAGCCGATGATCAAAAGAAAGGATATAAACGCTCTGCCTAAG
TCTGTGGCGCGGCCGCGAGGGCAGGCGACCAAGGACAAGCAACCGACGACCCTGCCCACGAATTTGGCGCCTTTC
AAGACTCAATCCGGCGCATTTCCGCGCCGAGATGGCGACAAGAGACGCAAGCCGGGTTCCAGAAGAGAGCCAGTG
ATTTTGTCGTCGAAGACTGATCGGCAAGCGTCTGGCCGTGAGACGGGCCGAGTTCCCTCCAAGGCGAAGGCGGGC
GATATGCCGGAAGAGGATCACGGTCACGCCTTGTCGGCGTTGCCTTCGACTTGGTTCCGCCAGGATGGTCCCATC
CCGGACCTGGAGGAGGAGCTCGAAAAGACGGCACGACTAGTTGCAAATACTAAACCTTCAGCCACAAGCAGACGA
CCGACGACGTCGACTCGGCGGCAGAAGCAGCCGACGCTCCGCTACGACCCAAACCACATGGGCATATGCTGCCGC
AGCAGCAGGGGGCTCCCTTCCCGGGCCACGGCCCCGCCCAATATCCCCATGAGAACCTCATCCGTCAAGGGCAGT
GTCAGCTCCGACGCGGACGACGAGGGCATCAAAGACGGCGACGTCTTGCGCGGGTTGCACGTGGCGGCTTCGGCT
GCTTGCGACCAGGAAGTGGATGCCTTCGTGCGCGACCAGACGGGGCTGCGGATCCGCCGCTTCCTGGCCGACTTG
ATGACGCTTGAAGCCTTTGGTCATCCGCTGCCGGGGGAGGGCAGCGAGCAGCGGGCGTGGCGGAGGAGGGCGGAG
ATGAGGCCGCTGAAGCGACGTGTCCGCCGTTCGCGCGAGCTGTCGGGCGTCGCTGGGGGGTTCATCTGA
Gene >Ophio5|4372
ATGCGTCTCTCCGGCCTCCAGAAAGACGTGCTATGCTTGTACCGCCAATGCCTCCGCGCCAGCCGCAGGAAGCCC
GAGGTGAAGTCCTCCCGAGTCTCCCGAGTGCGGACTGCAATCTTGGCTGACTTCCCACGACAGGACACCCGCTCT
CACTTCGAGTCCTTCGTCAGGTGGGCCTTCTCGGATGGATATCATGAGCTGGGCCTGATCATTACTGAGCTTCCG
CCGTCTCCCCTTCCTGCCTACCTAGGGCCGAGTTTACTCGCCACATGAGCATCGACAAGCGCGACTTTGACACGA
TCGAGTTCCTACTGCGCAAAGGCCGAAGACAGCTACAGGTGTACGCTGCTCCCGACATCAAAGATGTCAGGTGAG
GTCCTCAGCCCCGGAGGCGACTGCCACGCCTCTTCCAGCTCTTCCAGTTCTTAGCTCCCCAGCTTGCCGCTGTCT
GCTTTCCTCGGCGCCGCTCACCTCCAGTCTCTCCTCCCAAGCACGACGCGTCTGGACCACTGATGATTGTCCTTT
TCGCGGGAATCAGCTGTTCAAACCCCTTAATTTCTTGAATACCTACCTACCTGTAGTCCCAGTTCAAGTCCACCT
TGTCCTGTCATTACTCTGTCACCAACATCAAGATGGCTACTCTAGCATCAATTCCAGAGGCAAGCACTTTGTTGC
CCAACACGCACGACTCCCGACCGCTTCAGCGGACTGCTTCCTTTGAGAGAATTCGGCCGCGATCTCGTGTCTTGA
TACTCTCCAGACGCCCAACCCGTGTCCGCAACCCGGCTCGGCGTGCGCCAGTCGCGGCGGCGCCGCGTCAAGCAA
GTGGTCAGAGACATCCGCCTGCAGAGGTTTCCTGCCGAGCGAGCTCTCACTTGGAGGCGAGCGACGTGACTCCAG
GTGACGCTCCAAAGGCACCGCAAAGAAGCCACAGCCGGCCGCCATACCACCGGTTCGATTCGGCCTCACCAACCG
ACCAGGCGCTGGAGACTTCTGTCTCTTCCGTCGACTTGGACTCGTTCCCTCTTCCGCCCTCGCATCGCGGGCTTG
CGAAAAGGTCTTCGCCGAACCCTCAGGCGGGGCCAAATCGGGATGGTGCCATTTCGCCCACCAGGGATGGGCCTT
TCTCGAGTGCGCGGCGGTGCTTTGGCGAGGTTGCCGCCGATGTTGCCAGAGCCTCGAAGCACTCGTCCATAGATT
CTACTCTCGTCGAAGCCATCTCAAGAACCATCGCTCAGCAGTTCCGCCTCCTCTCCGTCGCCAAGTACGCCGACC
GGGAATTGATTCATCCATCAAGATCCAGCTTCTCACCTTCATTTGCCCATGCCAGCCGACCTGAAAAACCAAGAC
GTCGGGATTCCCTTGATCGTTTTACCGCTGACCTCTACAAATACGCATACAACACTGGGCCCAGGGATGAAGCTG
AGCAATCGTCACCCGATCCTCCCAGGTCTGGGGAGAGCCTTCACACAGTGTCTGCCCTGATGCCCTTCCGTCCAG
AGTTTAGGGCGGCAGGGCTCGCCGTGACATCCAAGGATCAAGCCGAACGCAGTCCTGGCTACTTGTCGAGAGCAT
ACGCGTCGCTGCGGTCACGTCAACTTCTATCCAAAGCCCCTCGAAACAGGAATCTGCACGCGTCTCAAATCGACG
GGCCAGGGGAGGTCCCGAGCTCCAGCACAAACACTGAGATCTCCTTCGCTCCGAGCCAGGCGGACGAATGGAGAA
GTGCCCTGATCGAAGAGGTGCCGGTGCGGAAAAAGAAGCGAGGCAAAAAGGCAAAAAGGCAAAGAAAGTCTTGTT
TTCCGTGTTTTCGTGGCAAGGAAAAGCCCGCCGCCGACGGAGATTGGGCACACTTCAGAGAAGCCCCGGAGAAGC
CAGCTGCAGACCGCCATGCCGCGTGGGAATCAAGGCCGACAAGGCCCAGACTGCCGCCCATCCTCCAGACGGCAG
AAACTCGACCCTCGCGTTTTGACTCTGTCCCCCGAAGCCCTAAACATGTGTCGATACCACAGCCGATGATCAAAA
GAAAGGATATAAACGCTCTGCCTAAGTCTGTGGCGCGGCCGCGAGGGCAGGCGACCAAGGACAAGCAACCGACGA
CCCTGCCCACGAATTTGGCGCCTTTCAAGACTCAATCCGGCGCATTTCCGCGCCGAGATGGCGACAAGAGACGCA
AGCCGGGTTCCAGGTCGGGGGCACTTCCGCCTCGGTCCAAGTCAGATTAGAGTGGACTGGCGCGTGGCGGGAAGA
GAAGAGAGCCAGTGATTTTGTCGTCGAAGACTGATCGGCAAGCGTCTGGCCGTGAGACGGGCCGAGTTCCCTCCA
AGGCGAAGGCGGGCGATATGCCGGAAGAGGATCACGGTCACGCCTTGTCGGCGTTGCCTTCGACTTGGTTCCGCC
AGGATGGTCCCATCCCGGACCTGGAGGAGGAGCTCGAAAAGACGGCACGACTAGTTGCAAATACTAAACCTTCAG
CCACAAGCAGACGACCGACGACGTCGACTCGGCGGCAGAAGCAGCCGACGCTCCGCTACGACCCAAACCACATGG
GCATATGCTGCCGCAGCAGCAGGGGGCTCCCTTCCCGGGCCACGGCCCCGCCCAATATCCCCATGAGAACCTCAT
CCGTCAAGGGCAGTGTCAGCTCCGACGCGGACGACGAGGGCATCAAAGACGGCGACGTCTTGCGCGGGTTGCACG
TGGCGGCTTCGGCTGCTTGCGACCAGGAAGTGGATGCCTTCGTGCGCGACCAGACGGGGCTGCGGATCCGCCGCT
TCCTGGCCGACTTGATGACGCTTGAAGCCTTTGGTCATCCGCTGCCGGGGGAGGGCAGCGAGCAGCGGGCGTGGC
GGAGGAGGGCGGAGATGAGGCCGCTGAAGCGACGTGTCCGCCGTTCGCGCGAGCTGTCGGGCGTCGCTGGGGGGT
TCATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail