Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4366
Gene name
Locationscaffold_346:604..2897
Strand-
Gene length (bp)2293
Transcript length (bp)1764
Coding sequence length (bp)1761
Protein length (aa) 587

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00735 Septin Septin 3.8E-08 246 372
PF00735 Septin Septin 1.3E-20 397 581

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P48008|SPN3_SCHPO Septin homolog spn3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn3 PE=1 SV=3 242 577 2.0E-20
sp|P54359|SEPT2_DROME Septin-2 OS=Drosophila melanogaster GN=Sep2 PE=2 SV=2 247 578 1.0E-19
sp|Q9DA97|SEP14_MOUSE Septin-14 OS=Mus musculus GN=Sept14 PE=1 SV=3 247 578 1.0E-19
sp|Q9NVA2|SEP11_HUMAN Septin-11 OS=Homo sapiens GN=SEPT11 PE=1 SV=3 247 585 2.0E-19
sp|A2VE99|SEP11_BOVIN Septin-11 OS=Bos taurus GN=SEPT11 PE=2 SV=1 247 585 2.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P48008|SPN3_SCHPO Septin homolog spn3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn3 PE=1 SV=3 242 577 2.0E-20
sp|P54359|SEPT2_DROME Septin-2 OS=Drosophila melanogaster GN=Sep2 PE=2 SV=2 247 578 1.0E-19
sp|Q9DA97|SEP14_MOUSE Septin-14 OS=Mus musculus GN=Sept14 PE=1 SV=3 247 578 1.0E-19
sp|Q9NVA2|SEP11_HUMAN Septin-11 OS=Homo sapiens GN=SEPT11 PE=1 SV=3 247 585 2.0E-19
sp|A2VE99|SEP11_BOVIN Septin-11 OS=Bos taurus GN=SEPT11 PE=2 SV=1 247 585 2.0E-19
sp|Q5R8U3|SEP11_PONAB Septin-11 OS=Pongo abelii GN=SEPT11 PE=2 SV=3 247 585 2.0E-19
sp|B3GNI6|SEP11_RAT Septin-11 OS=Rattus norvegicus GN=Sept11 PE=1 SV=1 247 585 2.0E-19
sp|Q8C1B7|SEP11_MOUSE Septin-11 OS=Mus musculus GN=Sept11 PE=1 SV=4 247 585 2.0E-19
sp|A6QQL3|SEP14_BOVIN Septin-14 OS=Bos taurus GN=SEPT14 PE=2 SV=1 247 579 3.0E-19
sp|Q4R555|SEP11_MACFA Septin-11 OS=Macaca fascicularis GN=SEPT11 PE=2 SV=3 247 585 7.0E-19
sp|Q5EB96|SEPT1_RAT Septin-1 OS=Rattus norvegicus GN=Sept1 PE=1 SV=1 247 578 1.0E-18
sp|Q80UG5|SEPT9_MOUSE Septin-9 OS=Mus musculus GN=Sept9 PE=1 SV=1 247 583 2.0E-18
sp|P42209|SEPT1_MOUSE Septin-1 OS=Mus musculus GN=Sept1 PE=1 SV=2 247 578 4.0E-18
sp|Q6AXA6|SEP8A_XENLA Septin-8-A OS=Xenopus laevis GN=sept8-a PE=2 SV=1 247 585 4.0E-18
sp|O36023|SPN1_SCHPO Septin homolog spn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn1 PE=1 SV=2 247 577 5.0E-18
sp|Q9UH03|SEPT3_HUMAN Neuronal-specific septin-3 OS=Homo sapiens GN=SEPT3 PE=1 SV=3 228 577 1.0E-17
sp|Q2KJB1|SEP10_BOVIN Septin-10 OS=Bos taurus GN=SEPT10 PE=2 SV=1 247 578 1.0E-17
sp|P40797|PNUT_DROME Protein peanut OS=Drosophila melanogaster GN=pnut PE=1 SV=2 200 577 1.0E-17
sp|Q9WU34|SEPT3_RAT Neuronal-specific septin-3 OS=Rattus norvegicus GN=Sept3 PE=1 SV=2 228 577 1.0E-17
sp|Q08DM7|SEPT3_BOVIN Neuronal-specific septin-3 OS=Bos taurus GN=SEPT3 PE=2 SV=3 228 577 1.0E-17
sp|Q9Z1S5|SEPT3_MOUSE Neuronal-specific septin-3 OS=Mus musculus GN=Sept3 PE=1 SV=2 228 577 1.0E-17
sp|Q9UHD8|SEPT9_HUMAN Septin-9 OS=Homo sapiens GN=SEPT9 PE=1 SV=2 171 577 2.0E-17
sp|B1H120|SEPT8_XENTR Septin-8 OS=Xenopus tropicalis GN=sept8 PE=2 SV=1 247 585 3.0E-17
sp|Q5PQK1|SEP10_RAT Septin-10 OS=Rattus norvegicus GN=Sept10 PE=1 SV=1 247 584 3.0E-17
sp|Q6IRQ5|SEP8B_XENLA Septin-8-B OS=Xenopus laevis GN=sept8-b PE=2 SV=1 247 585 3.0E-17
sp|Q8WYJ6|SEPT1_HUMAN Septin-1 OS=Homo sapiens GN=SEPT1 PE=1 SV=2 247 578 3.0E-17
sp|B1MTN8|SEPT8_CALMO Septin-8 OS=Callicebus moloch GN=SEPT8 PE=3 SV=1 247 585 4.0E-17
sp|Q0VCP4|SEPT8_BOVIN Septin-8 OS=Bos taurus GN=SEPT8 PE=2 SV=3 247 585 4.0E-17
sp|Q5REG8|SEP10_PONAB Septin-10 OS=Pongo abelii GN=SEPT10 PE=2 SV=1 247 584 4.0E-17
sp|A4FUM1|SEP8B_DANRE Septin-8-B OS=Danio rerio GN=sept8b PE=2 SV=1 247 585 5.0E-17
sp|Q8C650|SEP10_MOUSE Septin-10 OS=Mus musculus GN=Sept10 PE=1 SV=1 247 584 5.0E-17
sp|B0KWP7|SEPT8_CALJA Septin-8 OS=Callithrix jacchus GN=SEPT8 PE=3 SV=1 247 585 5.0E-17
sp|Q9P0V9|SEP10_HUMAN Septin-10 OS=Homo sapiens GN=SEPT10 PE=1 SV=2 247 584 6.0E-17
sp|Q642H3|SEP8A_DANRE Septin-8-A OS=Danio rerio GN=sept8a PE=2 SV=2 247 585 6.0E-17
sp|B2KIE9|SEPT8_RHIFE Septin-8 OS=Rhinolophus ferrumequinum GN=SEPT8 PE=3 SV=1 247 585 6.0E-17
sp|Q8CHH9|SEPT8_MOUSE Septin-8 OS=Mus musculus GN=Sept8 PE=1 SV=4 247 585 7.0E-17
sp|B5FW69|SEPT8_OTOGA Septin-8 OS=Otolemur garnettii GN=SEPT8 PE=3 SV=1 247 585 7.0E-17
sp|Q92599|SEPT8_HUMAN Septin-8 OS=Homo sapiens GN=SEPT8 PE=1 SV=4 247 585 8.0E-17
sp|Q5BKN4|SEP2A_XENTR Septin-2A OS=Xenopus tropicalis GN=sept2-A PE=2 SV=1 221 578 8.0E-17
sp|Q9QZR6|SEPT9_RAT Septin-9 OS=Rattus norvegicus GN=Sept9 PE=1 SV=1 247 583 8.0E-17
sp|G1UB61|CDC11_CANAL Septin CDC11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC11 PE=1 SV=1 223 584 8.0E-17
sp|Q5ZMH1|SEPT2_CHICK Septin-2 OS=Gallus gallus GN=SEPT2 PE=2 SV=1 221 578 9.0E-17
sp|Q59VX8|SHS1_CANAL Septation protein 7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEP7 PE=1 SV=1 238 577 1.0E-16
sp|Q6GLZ5|SEPT7_XENLA Septin-7 OS=Xenopus laevis GN=sept7 PE=2 SV=1 229 577 1.0E-16
sp|B0BNF1|SEPT8_RAT Septin-8 OS=Rattus norvegicus GN=Sept8 PE=1 SV=1 247 585 1.0E-16
sp|Q07657|SHS1_YEAST Seventh homolog of septin 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHS1 PE=1 SV=1 232 577 1.0E-16
sp|O43236|SEPT4_HUMAN Septin-4 OS=Homo sapiens GN=SEPT4 PE=1 SV=1 235 578 2.0E-16
sp|Q5R6R7|SEPT4_PONAB Septin-4 OS=Pongo abelii GN=SEPT4 PE=2 SV=1 235 578 2.0E-16
sp|P32458|CDC11_YEAST Cell division control protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC11 PE=1 SV=1 225 577 2.0E-16
sp|Q4R4X5|SEPT4_MACFA Septin-4 OS=Macaca fascicularis GN=SEPT4 PE=2 SV=1 235 578 2.0E-16
sp|A5PJU9|SEPT1_BOVIN Septin-1 OS=Bos taurus GN=SEPT1 PE=2 SV=1 247 578 3.0E-16
sp|Q4V8G5|SEP12_RAT Septin-12 OS=Rattus norvegicus GN=Sept12 PE=1 SV=2 237 577 3.0E-16
sp|Q8IYM1|SEP12_HUMAN Septin-12 OS=Homo sapiens GN=SEPT12 PE=1 SV=1 237 578 3.0E-16
sp|Q5RA66|SEPT2_PONAB Septin-2 OS=Pongo abelii GN=SEPT2 PE=2 SV=1 229 578 4.0E-16
sp|Q15019|SEPT2_HUMAN Septin-2 OS=Homo sapiens GN=SEPT2 PE=1 SV=1 229 578 5.0E-16
sp|Q2NKY7|SEPT2_BOVIN Septin-2 OS=Bos taurus GN=SEPT2 PE=2 SV=1 229 578 6.0E-16
sp|P42208|SEPT2_MOUSE Septin-2 OS=Mus musculus GN=Sept2 PE=1 SV=2 229 578 7.0E-16
sp|A5D7Q3|SEP12_BOVIN Septin-12 OS=Bos taurus GN=SEPT12 PE=2 SV=1 237 578 9.0E-16
sp|Q91Y81|SEPT2_RAT Septin-2 OS=Rattus norvegicus GN=Sept2 PE=1 SV=1 229 578 1.0E-15
sp|P28661|SEPT4_MOUSE Septin-4 OS=Mus musculus GN=Sept4 PE=1 SV=1 235 578 1.0E-15
sp|A2BGU8|SEPT3_DANRE Neuronal-specific septin-3 OS=Danio rerio GN=sept3 PE=2 SV=1 228 577 1.0E-15
sp|Q14141|SEPT6_HUMAN Septin-6 OS=Homo sapiens GN=SEPT6 PE=1 SV=4 247 585 2.0E-15
sp|Q9DE33|SEP2A_XENLA Septin-2A OS=Xenopus laevis GN=sept2-a PE=1 SV=1 229 578 2.0E-15
sp|Q3SZN0|SEPT6_BOVIN Septin-6 OS=Bos taurus GN=SEPT6 PE=2 SV=1 247 585 2.0E-15
sp|Q6ZU15|SEP14_HUMAN Septin-14 OS=Homo sapiens GN=SEPT14 PE=1 SV=2 247 578 2.0E-15
sp|Q9BGQ3|SEPT5_MACFA Septin-5 OS=Macaca fascicularis GN=Sept5 PE=2 SV=1 235 578 4.0E-15
sp|Q9JJM9|SEPT5_RAT Septin-5 OS=Rattus norvegicus GN=Sept5 PE=1 SV=2 235 578 4.0E-15
sp|Q0VC68|SEPT5_BOVIN Septin-5 OS=Bos taurus GN=SEPT5 PE=2 SV=1 235 578 4.0E-15
sp|Q99719|SEPT5_HUMAN Septin-5 OS=Homo sapiens GN=SEPT5 PE=1 SV=1 235 578 4.0E-15
sp|P42207|SEPT1_DROME Septin-1 OS=Drosophila melanogaster GN=Sep1 PE=1 SV=1 229 577 4.0E-15
sp|Q9R1T4|SEPT6_MOUSE Septin-6 OS=Mus musculus GN=Sept6 PE=1 SV=4 247 585 5.0E-15
sp|A1L0Y5|SEP2B_XENTR Septin-2B OS=Xenopus tropicalis GN=sept2-B PE=2 SV=1 229 578 7.0E-15
sp|P32468|CDC12_YEAST Cell division control protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC12 PE=1 SV=1 247 578 7.0E-15
sp|Q9Z2Q6|SEPT5_MOUSE Septin-5 OS=Mus musculus GN=Sept5 PE=1 SV=2 235 578 8.0E-15
sp|Q63ZQ1|SEP2B_XENLA Septin-2B OS=Xenopus laevis GN=sept2-b PE=2 SV=1 229 578 8.0E-15
sp|P48009|SPN4_SCHPO Septin homolog spn4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn4 PE=1 SV=1 242 580 4.0E-12
sp|Q09116|SPN2_SCHPO Septin homolog spn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn2 PE=1 SV=2 227 577 1.0E-11
sp|P32457|CDC3_YEAST Cell division control protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC3 PE=1 SV=3 229 577 5.0E-11
sp|P48010|SPN5_SCHPO Septin homolog spn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn5 PE=1 SV=2 228 577 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0017076 purine nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0019001 guanyl nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 190.26 93.20 287.31
CcL In ants, during behavior modification 55.51 25.99 85.02
CcD In ants, recently dead 99.92 52.95 146.90

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.004810 yes
CcL CcD 0.014705 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4366
MMLITLTPVGTPSSCLAAPLVSSLLFSSSASAFFSSFFFFIFFLSLSPSLHHTNLRSSPSPTPSHPFFLVGILSP
QLQTLPIAALDTTTRAPSSPSAVRNRPSLSCLPIMTSSPRRPSFGMLLRRSKSGDFGKGAKKKEVELDRQRMNPP
VLPEFRKSNDHLSKSFAPELQPAPAYSLSASPSARVSQETPRNYAAPIYPPVPPIPFDIYARTESMTHRGRYSYA
SSAVSTINGPRRVRRRKDPTPFNILIVGTAGAGKTSFLEFLKAAAALPAHKRPTKRPEEDDFRVPTLPTGNFVPH
YLESEMDKERIGLTLWDSEGLEKNVVDLQLREMLAFLESKFEETFNEEMKVIRSPGFQDTHIHAVILVLDPARLD
RNVAAARKLSTGGHSNGSTHGLQPFGALDEDVDLQVLRALHGKTTVIPVIGKADTVTTKHMNVLKRAVWSSIKAA
KVDPLEALGLDEDGESDRIDEDDDESVDKNGNGMIPYSPSGSSSTRLSGHSTPKDDDKPFLPFSVISPDLYEPGV
VGRRFPWGFADPYNEQHCDFQRLKEAIFSDWRADLRDASRDQWYEAWRTNRLKLRDTAYRRR
Coding >Ophio5|4366
ATGATGCTAATAACCTTGACCCCCGTAGGCACCCCCTCATCTTGCCTTGCCGCTCCTCTTGTGTCTTCTCTCCTC
TTCTCCTCTTCCGCTTCCGCTTTCTTCTCCTCCTTCTTCTTCTTCATCTTCTTCCTCTCCCTCTCTCCCTCCCTC
CATCATACCAACCTTCGTTCATCGCCCTCTCCGACGCCCTCTCATCCATTTTTCTTGGTCGGTATTCTATCGCCT
CAGCTCCAGACGCTTCCAATAGCCGCGTTGGATACCACGACTCGTGCGCCCAGCAGCCCGTCTGCTGTTCGCAAT
CGCCCCTCTCTGAGCTGTCTGCCCATCATGACCAGCTCTCCACGTCGCCCTAGCTTCGGCATGTTACTCCGCCGA
TCCAAGAGCGGCGACTTCGGAAAGGGCGCCAAAAAGAAGGAGGTCGAGTTGGATCGCCAGCGCATGAATCCTCCC
GTGCTGCCCGAGTTTCGCAAATCCAACGACCACTTGTCCAAGTCATTCGCGCCCGAGCTTCAGCCCGCCCCAGCA
TATAGCCTCTCCGCTTCCCCTTCCGCTCGCGTTTCTCAGGAAACGCCTCGCAACTACGCCGCCCCCATCTATCCT
CCCGTACCTCCCATCCCCTTCGACATTTACGCCAGAACCGAGAGCATGACCCACCGAGGCCGTTACAGCTATGCC
AGCAGCGCAGTCAGCACCATCAACGGCCCTAGGAGGGTTCGCAGGCGGAAGGATCCCACCCCGTTCAATATTCTC
ATCGTCGGAACCGCCGGCGCCGGCAAGACGTCCTTTCTCGAGTTTTTAAAAGCCGCTGCCGCCCTGCCGGCCCAT
AAACGGCCCACCAAGAGACCCGAAGAAGACGATTTCCGTGTCCCGACGTTGCCCACCGGCAACTTCGTCCCCCAC
TACCTAGAGTCCGAGATGGACAAGGAGCGCATCGGCCTGACACTCTGGGACTCGGAGGGTCTGGAGAAGAATGTC
GTCGACCTACAGCTCAGAGAAATGCTGGCTTTCCTCGAGAGCAAGTTCGAGGAGACGTTCAACGAGGAGATGAAG
GTGATTCGCTCGCCCGGCTTTCAGGACACTCACATCCACGCCGTCATCTTGGTCTTGGATCCGGCGCGCCTCGAC
CGCAACGTGGCTGCGGCCCGCAAGTTGTCTACTGGAGGCCATTCCAACGGCAGCACACACGGCCTACAGCCGTTT
GGCGCCCTCGACGAGGACGTCGACTTGCAGGTGCTTCGCGCACTCCACGGCAAGACCACCGTCATCCCCGTCATC
GGCAAAGCCGACACCGTCACGACAAAGCACATGAACGTGCTGAAGCGAGCCGTTTGGAGCAGCATCAAGGCGGCC
AAGGTCGATCCCCTCGAGGCCTTGGGCCTTGACGAGGATGGGGAGTCGGACAGAATCGACGAAGACGACGATGAG
TCGGTAGACAAGAATGGCAATGGCATGATACCGTACTCGCCATCTGGCAGCAGCTCGACGCGCCTGTCGGGCCAC
TCGACGCCCAAGGACGACGACAAGCCGTTTCTCCCCTTTTCCGTCATCAGTCCCGACCTGTACGAGCCGGGTGTC
GTCGGTCGGCGGTTCCCCTGGGGCTTCGCCGACCCTTACAACGAGCAGCACTGCGACTTTCAGCGCCTCAAGGAA
GCCATCTTCTCCGACTGGCGCGCCGACCTGCGCGATGCGAGTCGCGACCAATGGTACGAGGCGTGGAGGACCAAT
CGGCTCAAGCTAAGAGACACCGCCTACCGCCGCCGG
Transcript >Ophio5|4366
ATGATGCTAATAACCTTGACCCCCGTAGGCACCCCCTCATCTTGCCTTGCCGCTCCTCTTGTGTCTTCTCTCCTC
TTCTCCTCTTCCGCTTCCGCTTTCTTCTCCTCCTTCTTCTTCTTCATCTTCTTCCTCTCCCTCTCTCCCTCCCTC
CATCATACCAACCTTCGTTCATCGCCCTCTCCGACGCCCTCTCATCCATTTTTCTTGGTCGGTATTCTATCGCCT
CAGCTCCAGACGCTTCCAATAGCCGCGTTGGATACCACGACTCGTGCGCCCAGCAGCCCGTCTGCTGTTCGCAAT
CGCCCCTCTCTGAGCTGTCTGCCCATCATGACCAGCTCTCCACGTCGCCCTAGCTTCGGCATGTTACTCCGCCGA
TCCAAGAGCGGCGACTTCGGAAAGGGCGCCAAAAAGAAGGAGGTCGAGTTGGATCGCCAGCGCATGAATCCTCCC
GTGCTGCCCGAGTTTCGCAAATCCAACGACCACTTGTCCAAGTCATTCGCGCCCGAGCTTCAGCCCGCCCCAGCA
TATAGCCTCTCCGCTTCCCCTTCCGCTCGCGTTTCTCAGGAAACGCCTCGCAACTACGCCGCCCCCATCTATCCT
CCCGTACCTCCCATCCCCTTCGACATTTACGCCAGAACCGAGAGCATGACCCACCGAGGCCGTTACAGCTATGCC
AGCAGCGCAGTCAGCACCATCAACGGCCCTAGGAGGGTTCGCAGGCGGAAGGATCCCACCCCGTTCAATATTCTC
ATCGTCGGAACCGCCGGCGCCGGCAAGACGTCCTTTCTCGAGTTTTTAAAAGCCGCTGCCGCCCTGCCGGCCCAT
AAACGGCCCACCAAGAGACCCGAAGAAGACGATTTCCGTGTCCCGACGTTGCCCACCGGCAACTTCGTCCCCCAC
TACCTAGAGTCCGAGATGGACAAGGAGCGCATCGGCCTGACACTCTGGGACTCGGAGGGTCTGGAGAAGAATGTC
GTCGACCTACAGCTCAGAGAAATGCTGGCTTTCCTCGAGAGCAAGTTCGAGGAGACGTTCAACGAGGAGATGAAG
GTGATTCGCTCGCCCGGCTTTCAGGACACTCACATCCACGCCGTCATCTTGGTCTTGGATCCGGCGCGCCTCGAC
CGCAACGTGGCTGCGGCCCGCAAGTTGTCTACTGGAGGCCATTCCAACGGCAGCACACACGGCCTACAGCCGTTT
GGCGCCCTCGACGAGGACGTCGACTTGCAGGTGCTTCGCGCACTCCACGGCAAGACCACCGTCATCCCCGTCATC
GGCAAAGCCGACACCGTCACGACAAAGCACATGAACGTGCTGAAGCGAGCCGTTTGGAGCAGCATCAAGGCGGCC
AAGGTCGATCCCCTCGAGGCCTTGGGCCTTGACGAGGATGGGGAGTCGGACAGAATCGACGAAGACGACGATGAG
TCGGTAGACAAGAATGGCAATGGCATGATACCGTACTCGCCATCTGGCAGCAGCTCGACGCGCCTGTCGGGCCAC
TCGACGCCCAAGGACGACGACAAGCCGTTTCTCCCCTTTTCCGTCATCAGTCCCGACCTGTACGAGCCGGGTGTC
GTCGGTCGGCGGTTCCCCTGGGGCTTCGCCGACCCTTACAACGAGCAGCACTGCGACTTTCAGCGCCTCAAGGAA
GCCATCTTCTCCGACTGGCGCGCCGACCTGCGCGATGCGAGTCGCGACCAATGGTACGAGGCGTGGAGGACCAAT
CGGCTCAAGCTAAGAGACACCGCCTACCGCCGCCGGTAG
Gene >Ophio5|4366
ATGATGCTAATAACCTTGACCCCCGTAGGTAGCCTGTACTTGAGGTGCGCGGTCCGGGAAGCGGTGGTGACAGGT
ACGGATACCGCAATCTCTCTCTTTCAGGCACCCCCTCATCTTGCCTTGCCGCTCCTCTTGTGTCTTCTCTCCTCT
TCTCCTCTTCCGCTTCCGCTTTCTTCTCCTCCTTCTTCTTCTTCATCTTCTTCCTCTCCCTCTCTCCCTCCCTCC
ATCATACCAACCTTCGTTCATCGCCCTCTCCGACGCCCTCTCATCCATTTTTCTTGGTCGGTATTCTATCGCCTC
AGGTAAGGCCGCATTCTTTCTCCTCCTCCTCCTCCTCCTCCTCCTCCTCCTGCCCCTCCTGCTCCTCCTCCCCTC
GCCTCACCTCGCCTCGCCTCGCCTCGCCCCTGGCACCTTCATGCAGTGCAGTCTGCCCCCCGTCATGGTCCCTGC
AGCTCCTCACAAACACTCACCACCATGACACACATGTGCACCCGCATACATATGCACGCCATGTTGCACTCCTCG
CCTTGTTTCGGCCGCTAAAAGCCACGCGCCGCTCGGTGCCCTTTGCTAAATTCTACCTCCCCTATCCTCCCCCCC
AGCTCCAGACGCTTCCAGTTAGCCTGCCGTCCTCTCCATGCCATTTCTCCACGCATGACCTCACTCGCTCTTCGG
CCGTCATCACCTACTATTTGGCACTTCAGATAGCCGCGTTGGATACCACGACTCGTGCGCCCAGCAGCCCGTCTG
CTGTTCGCAATCGCCCCTCTCTGAGCTGTCTGCCCATCATGACCAGCTCTCCACGTCGCCCTAGCTTCGGCATGT
TACTCCGCCGATCCAAGAGCGGCGACTTCGGAAAGGGCGCCAAAAAGAAGGAGGTCGAGTTGGATCGCCAGCGCA
TGAATCCTCCCGTGCTGCCCGAGTTTCGCAAATCCAACGACCACTTGTCCAAGTCATTCGCGCCCGAGCTTCAGC
CCGCCCCAGCATATAGCCTCTCCGCTTCCCCTTCCGCTCGCGTTTCTCAGGAAACGCCTCGCAACTACGCCGCCC
CCATCTATCCTCCCGTACCTCCCATCCCCTTCGACATTTACGCCAGAACCGAGAGCATGACCCACCGAGGCCGTT
ACAGCTATGCCAGCAGCGCAGTCAGCACCATCAACGGCCCTAGGAGGGTTCGCAGGCGGAAGGATCCCACCCCGT
TCAAGTAGGACCACCAGCCCCTTTGATCTTGATGCTCTCTCCTTCGTTTTCGTCCCTGACGTTGATCTGCAGTAT
TCTCATCGTCGGAACCGCCGGCGCCGGCAAGACGTCCTTTCTCGAGTTTTTAAAAGCCGCTGCCGCCCTGCCGGC
CCATAAACGGCCCACCAAGAGACCCGAAGAAGACGATTTCCGTGTCCCGACGTTGCCCACCGGCAACTTCGTCCC
CCACTACCTAGAGTCCGAGATGGACAAGGAGCGCATCGGCCTGACACTCTGGGACTCGGAGGGTCTGGAGAAGAA
TGTCGTCGACCTACAGCTCAGAGAAATGCTGGCTTTCCTCGAGAGCAAGTTCGAGGAGACGTTCAACGAGGAGAT
GAAGGTGATTCGCTCGCCCGGCTTTCAGGACACTCACATCCACGCCGTCATCTTGGTCTTGGATCCGGCGCGCCT
CGACCGCAACGTGGCTGCGGCCCGCAAGTTGTCTACTGGAGGCCATTCCAACGGCAGCACACACGGCCTACAGCC
GTTTGGCGCCCTCGACGAGGACGTCGACTTGCAGGTGCTTCGCGCACTCCACGGCAAGACCACCGTCATCCCCGT
CATCGGCAAAGCCGACACCGTCACGACAAAGCACATGAACGTGCTGAAGCGAGCCGTTTGGAGCAGCATCAAGGC
GGCCAAGGTCGATCCCCTCGAGGCCTTGGGCCTTGACGAGGATGGGGAGTCGGACAGAATCGACGAAGACGACGA
TGAGTCGGTAGACAAGAATGGCAATGGCATGATACCGTACTCGCCATCTGGCAGCAGCTCGACGCGCCTGTCGGG
CCACTCGACGCCCAAGGACGACGACAAGCCGTTTCTCCCCTTTTCCGTCATCAGTCCCGACCTGTACGAGCCGGG
TGTCGTCGGTCGGCGGTTCCCCTGGGGCTTCGCCGACCCTTACAACGAGCAGCACTGCGACTTTCAGCGCCTCAA
GGAAGCCATCTTCTCCGACTGGCGCGCCGACCTGCGCGATGCGAGTCGCGACCAATGGTACGAGGCGTGGAGGAC
CAATCGGCTCAAGCTAAGAGACACCGCCTACCGCCGCCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail