Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4362
Gene name
Locationscaffold_345:10082..11562
Strand+
Gene length (bp)1480
Transcript length (bp)1380
Coding sequence length (bp)1377
Protein length (aa) 459

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04678 MCU Mitochondrial calcium uniporter 2.3E-23 253 376

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8VYR0|MCU5_ARATH Calcium uniporter protein 5, mitochondrial OS=Arabidopsis thaliana GN=At1g57610 PE=2 SV=1 268 376 5.0E-13
sp|F4I111|MCU6_ARATH Calcium uniporter protein 6, mitochondrial OS=Arabidopsis thaliana GN=At1g09575 PE=2 SV=1 268 397 1.0E-11

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 293 312 19
2 322 341 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4362
MSCVLRRPVARLALGWSLKPLPSASRSISASLARPRDERKPESAHDQWQRVTTSKSQQRKVNDRPWQRENSNALP
KATSHDPSGGDGTKGRLLTTPTRLLKLILPMPFHPEQEHINASEEEKRRWSKRAVEPLALLVHPQQPLSYLERLI
QAEIPPMRTDGREKLPELVFRAEAAGHAETEGPSDERHGANVAAYSGLGREGPGNSDETRWVRWSSSTEVGDFIR
DAARGREFAIGIEGLDHELRVAVPSFKDRTYYLRTRLRKMSLQIDQMSGVKKECDLLAHQGAHRLAKGGFAALAG
WWGIVYYVTFHTDMGWDLVEPITYLAGLTTIMGGYLWFLFISRDLSYKAAMNLTVSRRQTALYQERGFDPRKWEQ
LVHEANLLRHEIKLAATEYDVEWDEMRDLGGEEVLEVLDKEEKEAERSDTKKKKKRGSRDEHGQEDDDDDTAKTS
KAKGGRAKE
Coding >Ophio5|4362
ATGAGTTGTGTCCTGCGGCGGCCGGTGGCTCGCCTCGCCCTCGGATGGAGTCTCAAGCCGCTGCCGTCCGCCAGC
CGCAGCATATCCGCCTCTCTTGCGCGCCCACGAGACGAGCGGAAACCGGAAAGCGCCCACGACCAATGGCAGCGT
GTGACGACGAGCAAGAGTCAGCAGAGAAAGGTCAATGACCGTCCGTGGCAACGTGAGAACAGCAATGCCCTGCCC
AAGGCCACGTCGCATGATCCGTCCGGCGGGGATGGCACAAAAGGACGACTATTGACGACGCCGACGCGGCTCCTG
AAGCTCATTCTGCCGATGCCCTTCCATCCGGAACAGGAGCACATCAACGCCAGCGAGGAGGAGAAGCGGAGGTGG
AGCAAGCGGGCTGTCGAGCCCTTGGCGCTTCTCGTGCATCCGCAGCAGCCCCTCTCGTACCTCGAGAGGCTGATT
CAGGCGGAGATACCGCCGATGCGGACCGACGGGCGGGAGAAGCTACCGGAGCTGGTCTTCCGAGCTGAGGCGGCG
GGCCACGCCGAAACGGAGGGCCCATCGGACGAGAGGCACGGCGCCAACGTCGCGGCCTACTCCGGCCTCGGACGC
GAAGGCCCCGGAAACAGTGACGAGACGAGATGGGTCCGCTGGAGCAGCAGCACCGAGGTGGGCGACTTTATTCGC
GACGCGGCGCGTGGGCGCGAGTTCGCCATCGGCATCGAGGGCCTGGATCACGAGCTGCGCGTTGCGGTGCCGAGC
TTCAAAGATCGGACGTATTACCTGCGCACTCGGCTTCGTAAGATGTCTCTACAAATCGATCAGATGTCGGGCGTC
AAGAAGGAATGCGACCTCCTCGCTCACCAGGGCGCTCATCGACTCGCAAAAGGCGGATTCGCCGCGCTGGCAGGC
TGGTGGGGGATCGTCTACTACGTCACCTTTCACACAGACATGGGATGGGACCTGGTGGAACCGATCACGTACCTG
GCCGGGCTGACGACCATCATGGGCGGCTACCTGTGGTTCCTCTTCATCAGCCGCGACCTGAGCTACAAAGCGGCC
ATGAACCTGACGGTATCCCGCCGCCAGACGGCTCTGTACCAGGAGCGTGGCTTCGACCCGCGCAAATGGGAGCAG
TTGGTTCACGAGGCCAATCTGCTGAGGCACGAGATCAAGCTTGCGGCGACAGAGTACGACGTCGAGTGGGATGAG
ATGCGCGACTTGGGCGGCGAGGAGGTCCTCGAGGTGTTGGACAAGGAGGAGAAGGAAGCGGAGCGCAGTGATACG
AAGAAGAAGAAGAAGCGCGGCAGCAGGGATGAGCATGGCCAAGAAGATGACGATGATGACACTGCCAAGACGAGC
AAGGCCAAGGGGGGGAGGGCAAAGGAG
Transcript >Ophio5|4362
ATGAGTTGTGTCCTGCGGCGGCCGGTGGCTCGCCTCGCCCTCGGATGGAGTCTCAAGCCGCTGCCGTCCGCCAGC
CGCAGCATATCCGCCTCTCTTGCGCGCCCACGAGACGAGCGGAAACCGGAAAGCGCCCACGACCAATGGCAGCGT
GTGACGACGAGCAAGAGTCAGCAGAGAAAGGTCAATGACCGTCCGTGGCAACGTGAGAACAGCAATGCCCTGCCC
AAGGCCACGTCGCATGATCCGTCCGGCGGGGATGGCACAAAAGGACGACTATTGACGACGCCGACGCGGCTCCTG
AAGCTCATTCTGCCGATGCCCTTCCATCCGGAACAGGAGCACATCAACGCCAGCGAGGAGGAGAAGCGGAGGTGG
AGCAAGCGGGCTGTCGAGCCCTTGGCGCTTCTCGTGCATCCGCAGCAGCCCCTCTCGTACCTCGAGAGGCTGATT
CAGGCGGAGATACCGCCGATGCGGACCGACGGGCGGGAGAAGCTACCGGAGCTGGTCTTCCGAGCTGAGGCGGCG
GGCCACGCCGAAACGGAGGGCCCATCGGACGAGAGGCACGGCGCCAACGTCGCGGCCTACTCCGGCCTCGGACGC
GAAGGCCCCGGAAACAGTGACGAGACGAGATGGGTCCGCTGGAGCAGCAGCACCGAGGTGGGCGACTTTATTCGC
GACGCGGCGCGTGGGCGCGAGTTCGCCATCGGCATCGAGGGCCTGGATCACGAGCTGCGCGTTGCGGTGCCGAGC
TTCAAAGATCGGACGTATTACCTGCGCACTCGGCTTCGTAAGATGTCTCTACAAATCGATCAGATGTCGGGCGTC
AAGAAGGAATGCGACCTCCTCGCTCACCAGGGCGCTCATCGACTCGCAAAAGGCGGATTCGCCGCGCTGGCAGGC
TGGTGGGGGATCGTCTACTACGTCACCTTTCACACAGACATGGGATGGGACCTGGTGGAACCGATCACGTACCTG
GCCGGGCTGACGACCATCATGGGCGGCTACCTGTGGTTCCTCTTCATCAGCCGCGACCTGAGCTACAAAGCGGCC
ATGAACCTGACGGTATCCCGCCGCCAGACGGCTCTGTACCAGGAGCGTGGCTTCGACCCGCGCAAATGGGAGCAG
TTGGTTCACGAGGCCAATCTGCTGAGGCACGAGATCAAGCTTGCGGCGACAGAGTACGACGTCGAGTGGGATGAG
ATGCGCGACTTGGGCGGCGAGGAGGTCCTCGAGGTGTTGGACAAGGAGGAGAAGGAAGCGGAGCGCAGTGATACG
AAGAAGAAGAAGAAGCGCGGCAGCAGGGATGAGCATGGCCAAGAAGATGACGATGATGACACTGCCAAGACGAGC
AAGGCCAAGGGGGGGAGGGCAAAGGAGTGA
Gene >Ophio5|4362
ATGAGTTGTGTCCTGCGGCGGCCGGTGGCTCGCCTCGCCCTCGGATGGAGTCTCAAGCCGCTGCCGTCCGCCAGC
CGCAGCATATCCGCCTCTCTTGCGCGCCCACGAGACGAGCGGAAACCGGAAAGCGCCCACGACCAATGGCAGCGT
GTGACGACGAGCAAGAGTCAGCAGAGAAAGGTCAATGACCGTCCGTGGCAACGTGAGAACAGCAATGCCCTGCCC
AAGGCCACGTCGCATGATCCGTCCGGCGGGGATGGCACAAAAGGTAAGGCGGATGGATAGGTTCCCCTGAATCAG
CTACGAGTCCTTACGGGACGGCAGATGGAAGGCAGCACAAGGGAAGCTGACGATGTGGGCGTCGGCAGGACGACT
ATTGACGACGCCGACGCGGCTCCTGAAGCTCATTCTGCCGATGCCCTTCCATCCGGAACAGGAGCACATCAACGC
CAGCGAGGAGGAGAAGCGGAGGTGGAGCAAGCGGGCTGTCGAGCCCTTGGCGCTTCTCGTGCATCCGCAGCAGCC
CCTCTCGTACCTCGAGAGGCTGATTCAGGCGGAGATACCGCCGATGCGGACCGACGGGCGGGAGAAGCTACCGGA
GCTGGTCTTCCGAGCTGAGGCGGCGGGCCACGCCGAAACGGAGGGCCCATCGGACGAGAGGCACGGCGCCAACGT
CGCGGCCTACTCCGGCCTCGGACGCGAAGGCCCCGGAAACAGTGACGAGACGAGATGGGTCCGCTGGAGCAGCAG
CACCGAGGTGGGCGACTTTATTCGCGACGCGGCGCGTGGGCGCGAGTTCGCCATCGGCATCGAGGGCCTGGATCA
CGAGCTGCGCGTTGCGGTGCCGAGCTTCAAAGATCGGACGTATTACCTGCGCACTCGGCTTCGTAAGATGTCTCT
ACAAATCGATCAGATGTCGGGCGTCAAGAAGGAATGCGACCTCCTCGCTCACCAGGGCGCTCATCGACTCGCAAA
AGGCGGATTCGCCGCGCTGGCAGGCTGGTGGGGGATCGTCTACTACGTCACCTTTCACACAGACATGGGATGGGA
CCTGGTGGAACCGATCACGTACCTGGCCGGGCTGACGACCATCATGGGCGGCTACCTGTGGTTCCTCTTCATCAG
CCGCGACCTGAGCTACAAAGCGGCCATGAACCTGACGGTATCCCGCCGCCAGACGGCTCTGTACCAGGAGCGTGG
CTTCGACCCGCGCAAATGGGAGCAGTTGGTTCACGAGGCCAATCTGCTGAGGCACGAGATCAAGCTTGCGGCGAC
AGAGTACGACGTCGAGTGGGATGAGATGCGCGACTTGGGCGGCGAGGAGGTCCTCGAGGTGTTGGACAAGGAGGA
GAAGGAAGCGGAGCGCAGTGATACGAAGAAGAAGAAGAAGCGCGGCAGCAGGGATGAGCATGGCCAAGAAGATGA
CGATGATGACACTGCCAAGACGAGCAAGGCCAAGGGGGGGAGGGCAAAGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail