Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4356
Gene name
Locationscaffold_344:19520..21808
Strand+
Gene length (bp)2288
Transcript length (bp)2169
Coding sequence length (bp)2166
Protein length (aa) 722

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-37 170 662
PF00083 Sugar_tr Sugar (and other) transporter 7.8E-09 188 333

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 119 715 4.0E-42
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 95 644 9.0E-35
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 93 333 1.0E-28
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 103 644 1.0E-23
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 101 347 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 119 715 4.0E-42
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 95 644 9.0E-35
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 93 333 1.0E-28
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 103 644 1.0E-23
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 101 347 2.0E-18
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 121 341 2.0E-17
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 147 329 3.0E-17
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 496 716 9.0E-17
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 72 360 7.0E-16
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 121 341 1.0E-15
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 69 352 2.0E-14
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 130 330 3.0E-14
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 130 330 3.0E-14
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 99 329 7.0E-14
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 136 339 1.0E-13
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 128 347 2.0E-13
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 157 329 2.0E-13
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 128 347 2.0E-13
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 78 341 4.0E-13
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 115 350 5.0E-13
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 83 339 2.0E-12
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 139 341 3.0E-12
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 186 329 5.0E-12
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 516 710 6.0E-12
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 157 329 6.0E-12
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 119 341 2.0E-11
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 113 341 2.0E-11
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 516 710 3.0E-11
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 136 347 3.0E-11
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 100 329 4.0E-11
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 175 360 5.0E-11
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 454 652 2.0E-10
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 128 367 5.0E-09
sp|P39386|MDTM_ECOLI Multidrug resistance protein MdtM OS=Escherichia coli (strain K12) GN=mdtM PE=1 SV=1 167 329 9.0E-09
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 130 376 1.0E-08
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 575 710 2.0E-08
sp|Q8XB84|MDTM_ECO57 Multidrug resistance protein MdtM OS=Escherichia coli O157:H7 GN=mdtM PE=3 SV=1 167 329 3.0E-08
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 539 710 3.0E-08
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 118 386 4.0E-08
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 128 330 7.0E-08
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 533 716 1.0E-07
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 176 342 2.0E-07
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 103 367 3.0E-07
sp|Q8XFG0|MDTM_SALTI Multidrug resistance protein MdtM OS=Salmonella typhi GN=mdtM PE=3 SV=1 167 329 5.0E-07
sp|Q7CP73|MDTM_SALTY Multidrug resistance protein MdtM OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtM PE=3 SV=1 167 329 5.0E-07
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 496 722 8.0E-07
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 174 309 2.0E-06
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 105 329 3.0E-06
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 174 348 3.0E-06
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 190 309 5.0E-06
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 190 309 5.0E-06
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 180 329 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 153 175 22
2 190 212 22
3 219 236 17
4 251 270 19
5 277 299 22
6 304 326 22
7 501 523 22
8 543 565 22
9 586 608 22
10 618 640 22
11 652 674 22
12 684 706 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4356
MSSPEDVKPSSSTRMKLPRAFARRLSAWHASSTENASSTEKPCRPKWSMGVLNDKETDEVPGSVLLLASDRNEPL
GLRNMRARTSHSSLPTGLPPDVGPFSRPQSMATPRLPQLEPIDEMKKTSDGAIILEPQPDDSANDPLNWPGWRRD
TALLSLGFYCMIGGGITPLIAAGFTDVASDLHVDVEIVSLTTGLYMMGLGLGSVLASPTAILFGKRPVYLGSAIV
FIATCLWAAWSPSFASLLAARVFQGVAISPVECLPSATIAEIFFLHERAYRIGIYTLLLLGGKNLVPLVSAAIIS
RFGWRWVFWTVAIVVGFGFVLLFLFVPETFWDRTPTKRASKRVSLLSRLSSRLAVHKTDQPATPSGKGAPPSPGA
AARHNELRVGFAPSSEGGSSSGGLGSPKTPDWPVPPSPQQAGETSRPETAPTWPPGHGGASGNVGYASNLDNEKI
PASALKAPPKVQAYTYNLRQQPAQTFVQQLKPFHGRLNHDNWFKVMLRPFVLFAYPSVLWAAAVYSCSIGWLIVI
SETMAVIYRDPHAYNFTALQTGLVYISPFVGGILGTGVAGKVSDIIVRAMSRRNGGLYEPEFRLIMVIPVLVTTC
IGLMGFGWSAQDKDPWIVPTIFFGILSFGCSLGSTTSITYCVDSYRQYAGEALVTLNFAKNIFHGLIFSLFVAHW
MAEDGPRMVYIWLGVIQLIVLLTTIPMYIYGKRARMWTARRNLMERL
Coding >Ophio5|4356
ATGTCGTCCCCCGAGGACGTCAAGCCGTCGTCGTCCACTCGGATGAAGCTGCCCCGCGCCTTTGCCAGGCGGCTG
TCGGCCTGGCATGCTTCGTCCACGGAGAACGCTTCTTCCACCGAGAAGCCGTGCCGTCCCAAGTGGAGCATGGGC
GTCCTCAACGACAAGGAGACGGATGAGGTTCCCGGTTCCGTACTGCTGCTCGCCTCGGACCGCAACGAGCCGCTG
GGGCTGCGCAACATGCGCGCGAGGACGTCGCATTCGTCCCTCCCGACGGGCCTCCCACCCGACGTCGGCCCCTTC
AGCCGGCCGCAGTCGATGGCCACGCCTCGCCTGCCCCAGCTCGAGCCCATCGACGAGATGAAGAAGACTAGCGAC
GGCGCCATCATCCTCGAACCTCAGCCCGACGACTCGGCCAACGACCCGCTCAACTGGCCCGGCTGGCGCCGCGAC
ACGGCCTTGTTGTCCCTGGGCTTCTACTGTATGATTGGCGGTGGCATCACGCCTCTCATAGCCGCCGGCTTCACC
GACGTGGCCTCGGATCTCCATGTCGACGTCGAGATCGTTTCTCTGACCACGGGTCTCTACATGATGGGTCTTGGT
TTGGGATCCGTTCTCGCGTCTCCCACAGCCATCTTGTTCGGCAAACGACCCGTCTACCTTGGTAGCGCCATTGTC
TTCATCGCCACCTGTTTGTGGGCGGCGTGGTCGCCAAGCTTTGCCTCCCTGTTGGCCGCCAGGGTCTTTCAGGGC
GTCGCCATCAGCCCCGTCGAATGCCTCCCGTCGGCCACCATTGCCGAGATATTTTTCCTCCACGAGCGCGCCTAT
CGCATCGGCATCTATACCCTGCTGCTTCTGGGCGGCAAGAACTTGGTGCCCCTGGTCAGCGCTGCCATCATCAGC
CGCTTCGGCTGGCGCTGGGTCTTTTGGACTGTCGCCATCGTCGTCGGCTTTGGCTTCGTCCTGCTCTTCCTCTTC
GTCCCAGAGACGTTTTGGGACAGAACGCCAACCAAGAGGGCGTCGAAGCGCGTGAGCCTGTTGAGTCGCCTGTCG
TCACGCCTCGCCGTGCACAAAACCGATCAGCCGGCGACGCCCAGCGGCAAGGGGGCGCCCCCGTCGCCCGGCGCA
GCGGCTCGCCACAACGAGCTCCGTGTGGGCTTCGCGCCGTCTTCCGAGGGCGGCAGCAGCAGCGGCGGCCTTGGG
TCGCCCAAGACGCCGGACTGGCCTGTTCCGCCCTCACCACAGCAGGCGGGCGAGACGAGCAGGCCGGAAACGGCG
CCGACGTGGCCCCCTGGTCATGGCGGCGCGTCTGGCAATGTCGGGTACGCGTCCAACCTGGACAATGAGAAGATT
CCGGCTTCGGCTCTCAAGGCGCCGCCCAAGGTGCAGGCTTACACGTATAACTTGCGTCAGCAGCCGGCGCAGACG
TTTGTGCAGCAGCTGAAGCCCTTCCACGGCCGCCTCAACCACGACAACTGGTTCAAGGTGATGCTGCGGCCGTTT
GTGCTGTTTGCCTACCCGTCGGTGCTGTGGGCAGCGGCCGTCTACTCGTGCTCGATCGGCTGGCTCATCGTCATC
TCGGAGACGATGGCCGTCATCTACCGCGACCCGCACGCCTACAACTTCACGGCGCTGCAGACGGGCCTGGTCTAC
ATCTCGCCCTTTGTCGGCGGCATCCTGGGCACCGGAGTGGCGGGCAAAGTCAGCGATATCATCGTGCGCGCCATG
TCGCGACGCAACGGGGGGCTGTACGAGCCCGAGTTCCGGCTCATCATGGTGATTCCGGTGCTCGTGACGACATGT
ATAGGGCTCATGGGCTTTGGCTGGTCGGCGCAGGACAAGGACCCGTGGATCGTGCCGACCATCTTCTTCGGCATA
CTGTCGTTTGGCTGCTCGCTGGGCTCGACGACGTCGATTACATATTGCGTCGACAGCTACCGCCAGTACGCGGGC
GAGGCCCTCGTCACGCTCAACTTCGCCAAGAACATCTTCCACGGGCTCATCTTCAGCCTGTTTGTGGCCCACTGG
ATGGCCGAGGACGGGCCGCGGATGGTGTACATTTGGCTGGGCGTCATTCAGCTGATTGTGCTGCTGACGACGATC
CCCATGTACATTTACGGCAAGCGGGCGCGCATGTGGACGGCGAGGCGGAATCTTATGGAGAGGTTA
Transcript >Ophio5|4356
ATGTCGTCCCCCGAGGACGTCAAGCCGTCGTCGTCCACTCGGATGAAGCTGCCCCGCGCCTTTGCCAGGCGGCTG
TCGGCCTGGCATGCTTCGTCCACGGAGAACGCTTCTTCCACCGAGAAGCCGTGCCGTCCCAAGTGGAGCATGGGC
GTCCTCAACGACAAGGAGACGGATGAGGTTCCCGGTTCCGTACTGCTGCTCGCCTCGGACCGCAACGAGCCGCTG
GGGCTGCGCAACATGCGCGCGAGGACGTCGCATTCGTCCCTCCCGACGGGCCTCCCACCCGACGTCGGCCCCTTC
AGCCGGCCGCAGTCGATGGCCACGCCTCGCCTGCCCCAGCTCGAGCCCATCGACGAGATGAAGAAGACTAGCGAC
GGCGCCATCATCCTCGAACCTCAGCCCGACGACTCGGCCAACGACCCGCTCAACTGGCCCGGCTGGCGCCGCGAC
ACGGCCTTGTTGTCCCTGGGCTTCTACTGTATGATTGGCGGTGGCATCACGCCTCTCATAGCCGCCGGCTTCACC
GACGTGGCCTCGGATCTCCATGTCGACGTCGAGATCGTTTCTCTGACCACGGGTCTCTACATGATGGGTCTTGGT
TTGGGATCCGTTCTCGCGTCTCCCACAGCCATCTTGTTCGGCAAACGACCCGTCTACCTTGGTAGCGCCATTGTC
TTCATCGCCACCTGTTTGTGGGCGGCGTGGTCGCCAAGCTTTGCCTCCCTGTTGGCCGCCAGGGTCTTTCAGGGC
GTCGCCATCAGCCCCGTCGAATGCCTCCCGTCGGCCACCATTGCCGAGATATTTTTCCTCCACGAGCGCGCCTAT
CGCATCGGCATCTATACCCTGCTGCTTCTGGGCGGCAAGAACTTGGTGCCCCTGGTCAGCGCTGCCATCATCAGC
CGCTTCGGCTGGCGCTGGGTCTTTTGGACTGTCGCCATCGTCGTCGGCTTTGGCTTCGTCCTGCTCTTCCTCTTC
GTCCCAGAGACGTTTTGGGACAGAACGCCAACCAAGAGGGCGTCGAAGCGCGTGAGCCTGTTGAGTCGCCTGTCG
TCACGCCTCGCCGTGCACAAAACCGATCAGCCGGCGACGCCCAGCGGCAAGGGGGCGCCCCCGTCGCCCGGCGCA
GCGGCTCGCCACAACGAGCTCCGTGTGGGCTTCGCGCCGTCTTCCGAGGGCGGCAGCAGCAGCGGCGGCCTTGGG
TCGCCCAAGACGCCGGACTGGCCTGTTCCGCCCTCACCACAGCAGGCGGGCGAGACGAGCAGGCCGGAAACGGCG
CCGACGTGGCCCCCTGGTCATGGCGGCGCGTCTGGCAATGTCGGGTACGCGTCCAACCTGGACAATGAGAAGATT
CCGGCTTCGGCTCTCAAGGCGCCGCCCAAGGTGCAGGCTTACACGTATAACTTGCGTCAGCAGCCGGCGCAGACG
TTTGTGCAGCAGCTGAAGCCCTTCCACGGCCGCCTCAACCACGACAACTGGTTCAAGGTGATGCTGCGGCCGTTT
GTGCTGTTTGCCTACCCGTCGGTGCTGTGGGCAGCGGCCGTCTACTCGTGCTCGATCGGCTGGCTCATCGTCATC
TCGGAGACGATGGCCGTCATCTACCGCGACCCGCACGCCTACAACTTCACGGCGCTGCAGACGGGCCTGGTCTAC
ATCTCGCCCTTTGTCGGCGGCATCCTGGGCACCGGAGTGGCGGGCAAAGTCAGCGATATCATCGTGCGCGCCATG
TCGCGACGCAACGGGGGGCTGTACGAGCCCGAGTTCCGGCTCATCATGGTGATTCCGGTGCTCGTGACGACATGT
ATAGGGCTCATGGGCTTTGGCTGGTCGGCGCAGGACAAGGACCCGTGGATCGTGCCGACCATCTTCTTCGGCATA
CTGTCGTTTGGCTGCTCGCTGGGCTCGACGACGTCGATTACATATTGCGTCGACAGCTACCGCCAGTACGCGGGC
GAGGCCCTCGTCACGCTCAACTTCGCCAAGAACATCTTCCACGGGCTCATCTTCAGCCTGTTTGTGGCCCACTGG
ATGGCCGAGGACGGGCCGCGGATGGTGTACATTTGGCTGGGCGTCATTCAGCTGATTGTGCTGCTGACGACGATC
CCCATGTACATTTACGGCAAGCGGGCGCGCATGTGGACGGCGAGGCGGAATCTTATGGAGAGGTTATGA
Gene >Ophio5|4356
ATGTCGTCCCCCGAGGACGTCAAGCCGTCGTCGTCCACTCGGATGAAGCTGCCCCGCGCCTTTGCCAGGCGGCTG
TCGGCCTGGCATGCTTCGTCCACGGAGAACGCTTCTTCCACCGAGAAGCCGTGCCGTCCCAAGTGGAGCATGGGC
GTCCTCAACGACAAGGAGACGGATGAGGTTCCCGGTATGACGTGCCCCGGCCTTGGCGCCTTGAACTCTGCTGAC
CCGTCCCTTGCCTTGGAAAGGTTCCGTACTGCTGCTCGCCTCGGACCGCAACGAGCCGCTGGGGCTGCGCAACAT
GCGCGCGAGGACGTCGCATTCGTCCCTCCCGACGGGCCTCCCACCCGACGTCGGCCCCTTCAGCCGGCCGCAGTC
GATGGCCACGCCTCGCCTGCCCCAGCTCGAGCCCATCGACGAGATGAAGAAGACTAGCGACGGCGCCATCATCCT
CGAACCTCAGCCCGACGACTCGGCCAACGACCCGCTCAACTGGCCCGGCTGGCGCCGCGACACGGCCTTGTTGTC
CCTGGGCTTCTACTGTATGATTGGCGGTGGCATCACGCCTCTCATAGCCGCCGGCTTCACCGACGTGGCCTCGGA
TCTCCATGTCGACGTCGAGATCGTTTCTCTGACCACGGGTCTCTACATGATGGGTCTTGGTTTGGGATCCGTTCT
CGCGTCTCCCACAGCCATCTTGTTCGGCAAACGACCCGTCTACCTTGGTAGCGCCATTGTCTTCATCGCCACCTG
TTTGTGGGCGGCGTGGTCGCCAAGCTTTGCCTCCCTGTTGGCCGCCAGGGTCTTTCAGGGCGTCGCCATCAGCCC
CGTCGAATGCCTCCCGTCGGCCACCATTGCCGAGATATTTTTCCTCCACGAGCGCGCCTATCGCATCGGCATCTA
TACCCTGCTGCTTCTGGGCGGCAAGAACTTGGTGCCCCTGGTCAGCGCTGCCATCATCAGCCGCTTCGGCTGGCG
CTGGGTCTTTTGGTACGTTTTTTTTTTCCCCGACGGCGTCTCTGTTCATCTGTGTCTGACACACTCGCAGGACTG
TCGCCATCGTCGTCGGCTTTGGCTTCGTCCTGCTCTTCCTCTTCGTCCCAGAGACGTTTTGGGACAGAACGCCAA
CCAAGAGGGCGTCGAAGCGCGTGAGCCTGTTGAGTCGCCTGTCGTCACGCCTCGCCGTGCACAAAACCGATCAGC
CGGCGACGCCCAGCGGCAAGGGGGCGCCCCCGTCGCCCGGCGCAGCGGCTCGCCACAACGAGCTCCGTGTGGGCT
TCGCGCCGTCTTCCGAGGGCGGCAGCAGCAGCGGCGGCCTTGGGTCGCCCAAGACGCCGGACTGGCCTGTTCCGC
CCTCACCACAGCAGGCGGGCGAGACGAGCAGGCCGGAAACGGCGCCGACGTGGCCCCCTGGTCATGGCGGCGCGT
CTGGCAATGTCGGGTACGCGTCCAACCTGGACAATGAGAAGATTCCGGCTTCGGCTCTCAAGGCGCCGCCCAAGG
TGCAGGCTTACACGTATAACTTGCGTCAGCAGCCGGCGCAGACGTTTGTGCAGCAGCTGAAGCCCTTCCACGGCC
GCCTCAACCACGACAACTGGTTCAAGGTGATGCTGCGGCCGTTTGTGCTGTTTGCCTACCCGTCGGTGCTGTGGG
CAGCGGCCGTCTACTCGTGCTCGATCGGCTGGCTCATCGTCATCTCGGAGACGATGGCCGTCATCTACCGCGACC
CGCACGCCTACAACTTCACGGCGCTGCAGACGGGCCTGGTCTACATCTCGCCCTTTGTCGGCGGCATCCTGGGCA
CCGGAGTGGCGGGCAAAGTCAGCGATATCATCGTGCGCGCCATGTCGCGACGCAACGGGGGGCTGTACGAGCCCG
AGTTCCGGCTCATCATGGTGATTCCGGTGCTCGTGACGACATGTATAGGGCTCATGGGCTTTGGCTGGTCGGCGC
AGGACAAGGACCCGTGGATCGTGCCGACCATCTTCTTCGGCATACTGTCGTTTGGCTGCTCGCTGGGCTCGACGA
CGTCGATTACATATTGCGTCGACAGCTACCGCCAGTACGCGGGCGAGGCCCTCGTCACGCTCAACTTCGCCAAGA
ACATCTTCCACGGGCTCATCTTCAGCCTGTTTGTGGCCCACTGGATGGCCGAGGACGGGCCGCGGATGGTGTACA
TTTGGCTGGGCGTCATTCAGCTGATTGTGCTGCTGACGACGATCCCCATGTACATTTACGGCAAGCGGGCGCGCA
TGTGGACGGCGAGGCGGAATCTTATGGAGAGGTTATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail