Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4354
Gene name
Locationscaffold_344:14273..16474
Strand-
Gene length (bp)2201
Transcript length (bp)1923
Coding sequence length (bp)1920
Protein length (aa) 640

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00188 CAP Cysteine-rich secretory protein family 2.9E-16 437 584

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P35794|SC7_SCHCO Fruiting body protein SC7 OS=Schizophyllum commune GN=SC7 PE=2 SV=1 437 586 6.0E-10
sp|A6QLZ7|CRLD2_BOVIN Cysteine-rich secretory protein LCCL domain-containing 2 OS=Bos taurus GN=CRISPLD2 PE=2 SV=1 427 584 3.0E-09
sp|Q4V9Y5|CRLD2_XENTR Cysteine-rich secretory protein LCCL domain-containing 2 OS=Xenopus tropicalis GN=crispld2 PE=2 SV=1 427 584 2.0E-08
sp|Q8BZQ2|CRLD2_MOUSE Cysteine-rich secretory protein LCCL domain-containing 2 OS=Mus musculus GN=Crispld2 PE=1 SV=1 425 584 2.0E-07
sp|Q9H0B8|CRLD2_HUMAN Cysteine-rich secretory protein LCCL domain-containing 2 OS=Homo sapiens GN=CRISPLD2 PE=2 SV=1 430 584 4.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P35794|SC7_SCHCO Fruiting body protein SC7 OS=Schizophyllum commune GN=SC7 PE=2 SV=1 437 586 6.0E-10
sp|A6QLZ7|CRLD2_BOVIN Cysteine-rich secretory protein LCCL domain-containing 2 OS=Bos taurus GN=CRISPLD2 PE=2 SV=1 427 584 3.0E-09
sp|Q4V9Y5|CRLD2_XENTR Cysteine-rich secretory protein LCCL domain-containing 2 OS=Xenopus tropicalis GN=crispld2 PE=2 SV=1 427 584 2.0E-08
sp|Q8BZQ2|CRLD2_MOUSE Cysteine-rich secretory protein LCCL domain-containing 2 OS=Mus musculus GN=Crispld2 PE=1 SV=1 425 584 2.0E-07
sp|Q9H0B8|CRLD2_HUMAN Cysteine-rich secretory protein LCCL domain-containing 2 OS=Homo sapiens GN=CRISPLD2 PE=2 SV=1 430 584 4.0E-07
sp|Q9H3Y0|CRSPL_HUMAN Peptidase inhibitor R3HDML OS=Homo sapiens GN=R3HDML PE=2 SV=1 412 585 8.0E-07
sp|P35795|SC14_SCHCO Fruiting body protein SC14 OS=Schizophyllum commune GN=SC14 PE=2 SV=1 437 584 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4354
MRSLYVVALALPLAAALPQFAPGTTVSSGGLSSAQWDVEDTDDNSEHDTRFSGEVKHSSGNDIFYTDQSRKLGDN
DDDNNYFYDEDDDFWDDEGTGDPDFVMGNAKDYQLARIDVDAKMKVKGEVQFAPSADESPSPVWTSSTKQVGGVD
ETVVDEARPPPGAIHYRPEPHSVQGKDEDERLTTASSTAAEPLASPDSGDDKSLDGLSTTGFPTSDAVVSEGDEG
VMKPALDSPLLQATEDGAPEWWMLTTPSAVDESRLHRTTASRESEDQAVVTSWTVAGRPQLTATVSLTQETVTVT
ATATATPVSKVTVGTQTEKDQDESAAMTSTVYWPSYLTSPYPPYLSKERSSDLVFPPTTEPSPLPEAGRIAYEDE
ENKMMLPPPPSPPEQAAAEKQADDKVEPSSPRPIDTAPVRPSSPKTALPVPASMRQQRNYALNLHNNVRTAHSAS
NLTWSAEQQDKALRWAQECVFEHPPTDREDVASHGQNIAFQSGSGTGSKLKGMRDSFKHWYYVESGWYDYDTAGL
STDATWTEETGYPQIGHFVNIVRKSFAELGCASHICKALRLDRSGGNSVPDAVFTVCNFGRSKQPKSANDDDVVT
PPVSPVPKLEDARWDASQQHGDDDDDDDNNNNNIIINKEE
Coding >Ophio5|4354
ATGCGGTCTTTGTATGTCGTGGCTCTGGCGCTGCCGCTCGCCGCGGCCCTGCCACAGTTCGCGCCGGGAACGACG
GTTTCCAGCGGTGGCTTGTCATCGGCGCAGTGGGACGTGGAGGATACGGACGACAACTCGGAGCATGACACGAGA
TTCAGCGGCGAGGTCAAGCACAGCAGCGGCAATGACATCTTTTACACCGACCAGAGCAGAAAGCTGGGCGACAAC
GACGACGACAACAACTACTTCTACGACGAAGACGACGATTTTTGGGATGACGAGGGCACCGGCGACCCCGACTTT
GTCATGGGCAACGCCAAGGACTACCAACTCGCGAGAATCGACGTCGATGCCAAGATGAAGGTGAAGGGGGAAGTC
CAGTTTGCCCCGTCGGCTGACGAGTCTCCGAGCCCCGTCTGGACGTCTTCGACGAAGCAAGTCGGCGGCGTCGAC
GAGACGGTGGTGGACGAGGCCAGGCCCCCACCGGGAGCTATCCACTACCGTCCTGAACCTCACAGCGTCCAGGGC
AAGGACGAGGACGAAAGACTGACGACGGCTTCCTCGACTGCCGCTGAGCCCCTGGCCAGTCCTGACAGCGGCGAC
GACAAGAGCTTGGATGGGTTGTCGACGACGGGCTTCCCGACGTCTGATGCCGTCGTCTCGGAGGGCGATGAAGGG
GTCATGAAGCCGGCTTTGGATAGCCCTCTTCTGCAAGCTACGGAAGACGGCGCTCCGGAATGGTGGATGTTGACG
ACTCCCTCGGCTGTTGATGAATCGCGTCTGCATCGTACCACTGCGTCGAGAGAGAGCGAGGACCAGGCTGTTGTC
ACGTCTTGGACTGTCGCGGGCCGTCCTCAGCTTACCGCCACCGTCTCTCTGACGCAGGAAACGGTGACTGTCACG
GCCACGGCCACGGCCACGCCCGTGTCCAAAGTGACGGTCGGCACGCAGACAGAGAAGGATCAGGACGAGTCGGCC
GCGATGACGTCCACCGTCTATTGGCCCTCTTACTTGACCTCCCCCTACCCGCCGTACCTGAGCAAGGAGAGATCA
TCAGACCTTGTTTTCCCGCCGACGACGGAGCCGAGTCCCTTGCCCGAAGCAGGTCGAATCGCGTACGAAGACGAG
GAGAACAAGATGATGCTGCCGCCGCCGCCGTCTCCTCCCGAACAGGCCGCGGCCGAGAAGCAAGCTGACGACAAG
GTCGAACCCTCCTCCCCCCGCCCCATCGACACGGCCCCTGTCCGACCCAGTAGTCCCAAGACGGCTCTCCCCGTC
CCGGCAAGCATGAGACAACAGCGCAACTACGCGCTCAACCTACACAACAACGTGCGCACAGCCCACTCGGCCTCG
AACCTGACGTGGAGCGCCGAGCAACAAGACAAAGCGCTCCGGTGGGCGCAGGAATGCGTCTTCGAGCACCCTCCT
ACCGACAGGGAAGACGTCGCCAGCCACGGACAGAACATCGCCTTCCAGAGCGGTTCCGGCACCGGCAGCAAGCTC
AAGGGTATGCGCGATAGCTTCAAGCATTGGTACTACGTCGAGAGCGGCTGGTACGATTACGATACGGCCGGCCTC
AGCACCGACGCTACCTGGACCGAGGAGACGGGCTATCCTCAGATCGGTCACTTTGTCAATATCGTTAGAAAGTCG
TTTGCCGAGTTGGGCTGTGCGTCGCATATTTGCAAAGCACTTCGTTTGGACAGGTCGGGAGGGAACTCGGTGCCG
GATGCCGTCTTTACCGTCTGCAACTTTGGCCGCTCCAAGCAGCCCAAGTCAGCAAACGACGACGACGTCGTCACC
CCGCCCGTCAGCCCCGTCCCCAAATTGGAAGACGCGCGGTGGGATGCGTCACAGCAGCACGGCGACGACGACGAC
GACGACGACAACAACAACAACAACATCATCATCAACAAGGAAGAA
Transcript >Ophio5|4354
ATGCGGTCTTTGTATGTCGTGGCTCTGGCGCTGCCGCTCGCCGCGGCCCTGCCACAGTTCGCGCCGGGAACGACG
GTTTCCAGCGGTGGCTTGTCATCGGCGCAGTGGGACGTGGAGGATACGGACGACAACTCGGAGCATGACACGAGA
TTCAGCGGCGAGGTCAAGCACAGCAGCGGCAATGACATCTTTTACACCGACCAGAGCAGAAAGCTGGGCGACAAC
GACGACGACAACAACTACTTCTACGACGAAGACGACGATTTTTGGGATGACGAGGGCACCGGCGACCCCGACTTT
GTCATGGGCAACGCCAAGGACTACCAACTCGCGAGAATCGACGTCGATGCCAAGATGAAGGTGAAGGGGGAAGTC
CAGTTTGCCCCGTCGGCTGACGAGTCTCCGAGCCCCGTCTGGACGTCTTCGACGAAGCAAGTCGGCGGCGTCGAC
GAGACGGTGGTGGACGAGGCCAGGCCCCCACCGGGAGCTATCCACTACCGTCCTGAACCTCACAGCGTCCAGGGC
AAGGACGAGGACGAAAGACTGACGACGGCTTCCTCGACTGCCGCTGAGCCCCTGGCCAGTCCTGACAGCGGCGAC
GACAAGAGCTTGGATGGGTTGTCGACGACGGGCTTCCCGACGTCTGATGCCGTCGTCTCGGAGGGCGATGAAGGG
GTCATGAAGCCGGCTTTGGATAGCCCTCTTCTGCAAGCTACGGAAGACGGCGCTCCGGAATGGTGGATGTTGACG
ACTCCCTCGGCTGTTGATGAATCGCGTCTGCATCGTACCACTGCGTCGAGAGAGAGCGAGGACCAGGCTGTTGTC
ACGTCTTGGACTGTCGCGGGCCGTCCTCAGCTTACCGCCACCGTCTCTCTGACGCAGGAAACGGTGACTGTCACG
GCCACGGCCACGGCCACGCCCGTGTCCAAAGTGACGGTCGGCACGCAGACAGAGAAGGATCAGGACGAGTCGGCC
GCGATGACGTCCACCGTCTATTGGCCCTCTTACTTGACCTCCCCCTACCCGCCGTACCTGAGCAAGGAGAGATCA
TCAGACCTTGTTTTCCCGCCGACGACGGAGCCGAGTCCCTTGCCCGAAGCAGGTCGAATCGCGTACGAAGACGAG
GAGAACAAGATGATGCTGCCGCCGCCGCCGTCTCCTCCCGAACAGGCCGCGGCCGAGAAGCAAGCTGACGACAAG
GTCGAACCCTCCTCCCCCCGCCCCATCGACACGGCCCCTGTCCGACCCAGTAGTCCCAAGACGGCTCTCCCCGTC
CCGGCAAGCATGAGACAACAGCGCAACTACGCGCTCAACCTACACAACAACGTGCGCACAGCCCACTCGGCCTCG
AACCTGACGTGGAGCGCCGAGCAACAAGACAAAGCGCTCCGGTGGGCGCAGGAATGCGTCTTCGAGCACCCTCCT
ACCGACAGGGAAGACGTCGCCAGCCACGGACAGAACATCGCCTTCCAGAGCGGTTCCGGCACCGGCAGCAAGCTC
AAGGGTATGCGCGATAGCTTCAAGCATTGGTACTACGTCGAGAGCGGCTGGTACGATTACGATACGGCCGGCCTC
AGCACCGACGCTACCTGGACCGAGGAGACGGGCTATCCTCAGATCGGTCACTTTGTCAATATCGTTAGAAAGTCG
TTTGCCGAGTTGGGCTGTGCGTCGCATATTTGCAAAGCACTTCGTTTGGACAGGTCGGGAGGGAACTCGGTGCCG
GATGCCGTCTTTACCGTCTGCAACTTTGGCCGCTCCAAGCAGCCCAAGTCAGCAAACGACGACGACGTCGTCACC
CCGCCCGTCAGCCCCGTCCCCAAATTGGAAGACGCGCGGTGGGATGCGTCACAGCAGCACGGCGACGACGACGAC
GACGACGACAACAACAACAACAACATCATCATCAACAAGGAAGAATAA
Gene >Ophio5|4354
ATGCGGTCTTTGTATGTCGTGGCTCTGGCGCTGCCGCTCGCCGCGGCCCTGCCACAGTTCGCGCCGGGAACGACG
GTTTCCAGCGGTGGCTTGTCATCGGCGCAGTGGGACGTGGAGGATACGGACGACAACTCGGAGCATGACACGAGA
TTCAGCGGCGAGGTCAAGCACAGCAGCGGCAATGACATCTTTTACACCGACCAGAGCAGAAAGCTGGGCGACAAC
GACGACGACAACAACTACTTCTACGACGAAGACGACGATTTTTGGGATGACGAGGGCACCGGCGACCCCGACTTT
GTCATGGGCAACGCCAAGGACTACCAACTCGCGAGAATCGACGTCGATGCCAAGATGAAGGTGAAGGGGGAAGTC
CAGTTTGCCCCGTCGGCTGACGAGTCTCCGAGCCCCGTCTGGACGTCTTCGACGAAGCAAGTCGGCGGCGTCGAC
GAGACGGTGGTGGACGAGGCCAGGCCCCCACCGGGAGCTATCCACTACCGTCCTGAACCTCACAGCGTCCAGGGC
AAGGACGAGGACGAAAGACTGACGACGGCTTCCTCGACTGCCGCTGAGCCCCTGGCCAGTCCTGACAGCGGCGAC
GACAAGAGCTTGGATGGGTTGTCGACGACGGGCTTCCCGACGTCTGATGCCGTCGTCTCGGAGGGCGATGAAGGG
GTCATGAAGCCGGCTTTGGATAGCCCTCTTCTGCAAGCTACGGAAGACGGCGCTCCGGAATGGTGGATGTTGACG
ACTCCCTCGGCTGTTGATGAATCGCGTCTGCATCGTACCACTGCGTCGAGAGAGAGCGAGGACCAGGCTGTTGTC
ACGTCTTGGACTGTCGCGGGCCGTCCTCAGCTTACCGCCACCGTCTCTCTGACGCAGGAAACGGTGACTGTCACG
GCCACGGCCACGGCCACGCCCGTGTCCAAAGTGACGGTCGGCACGCAGACAGAGAAGGATCAGGACGAGTCGGCC
GCGATGACGTCCACCGTCTATTGGCCCTCTTACTTGACCTCCCCCTACCCGCCGTACCTGAGCAAGGAGAGATCA
TCAGACCTTGTTTTCCCGCCGACGACGGAGCCGAGTCCCTTGCCCGAAGCAGGTCGAATCGCGTACGAAGACGAG
GAGAACAAGATGATGCTGCCGCCGCCGCCGTCTCCTCCCGAACAGGCCGCGGCCGAGAAGCAAGCTGACGACAAG
GTCGAACCCTCCTCCCCCCGCCCCATCGACACGGCCCCTGTCCGACCCAGTAGTCCCAAGACGGCTCTCCCCGTC
CCGGCAAGCATGAGACAACAGCGCAACTACGCGCTCAACCTACACAACAACGTGCGCACAGCCCACTCGGCCTCG
AACCTGACGTGGAGCGCCGAGCAACAAGACAAAGCGCTCCGGTGGGCGCAGGAATGCGTCTTCGAGCACCCTCCT
ACCGACAGGGAAGACGTCGCCAGCCACGGACAGAACATCGCCTTCCAGAGCGGTTCCGGCACCGGCAGCAAGCTC
AAGGGTATGCGCGATAGCTTCAAGCATTGGTACTACGTCGAGAGCGGCTGGTACGATTACGATACGGCCGGCCTC
AGCACCGACGCTACCTGGACCGAGGAGACGGGCTATCCTCAGATCGGTCACTTTGTCAATATCGTTAGAAAGTCG
TTTGCCGAGTTGGGCTGTGCGTCGCATATTTGCAAAGCACTTCGTTTGGACAGGTCGGGAGGGAACTCGGTGCCG
GATGCCGTCTTTACCGTCTGCAACTTTGGCCGCTCCAAGCAGCCCAAGTGTAAGCCTCTTTCTCTCTCTCTTCCT
CTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTTCCTCTCTTCCTCACTCACTCTCTCTCTCTCTTCCTCTC
TTCCTCACTCACTCTCTCTCTCTCTCTTCCTCTCTCTCACACACACACACTCTCTCTCTCTTCCTCTCTCATCAA
CATCCCCTCTCCCCCTCCCTTCCCTTCTTCTCTCCTTGCTACCTGATCCCCTCCTCCAGATTAAAAAAAAAAAAA
AGGTATCGACTAACACAAACTCGACAGCAGCAAACGACGACGACGTCGTCACCCCGCCCGTCAGCCCCGTCCCCA
AATTGGAAGACGCGCGGTGGGATGCGTCACAGCAGCACGGCGACGACGACGACGACGACGACAACAACAACAACA
ACATCATCATCAACAAGGAAGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail