Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4343
Gene name
Locationscaffold_343:13213..13810
Strand+
Gene length (bp)597
Transcript length (bp)453
Coding sequence length (bp)450
Protein length (aa) 150

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 40 59 19
3 71 93 22
4 113 135 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 92.24 42.06 142.41
CcL In ants, during behavior modification 300.52 151.56 449.49
CcD In ants, recently dead 180.06 94.89 265.22

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.008585 yes
CcL CcD 0.031173 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4343
MQLHAILAAVLHAACFIAALVVCGLYGHDLRVGYTHDSKWVYAIVVGGLSAVTCLVYAVPKTLHRINVPAASWSL
VLFILWIAVFGVFGSMYIKKGYGNSESDQHTRHMKVAVWFDLVSALLWLVSAISLCGYWWTRGDRRSRFTGRAYV
Coding >Ophio5|4343
ATGCAGCTTCACGCCATCCTCGCCGCCGTCTTGCACGCCGCTTGCTTCATCGCTGCTCTAGTTGTCTGTGGCCTG
TACGGACACGATCTGCGCGTCGGGTACACGCACGACTCGAAATGGGTCTATGCCATCGTCGTTGGCGGTCTCTCT
GCCGTCACGTGCTTGGTTTATGCCGTGCCCAAGACGCTCCATCGAATCAACGTACCTGCCGCTAGCTGGAGCCTT
GTGCTGTTCATCCTATGGATTGCCGTCTTTGGCGTCTTCGGCTCGATGTACATCAAAAAGGGGTATGGCAATTCT
GAAAGCGACCAACATACTAGACACATGAAGGTGGCCGTGTGGTTCGACCTGGTCAGCGCGCTGCTGTGGCTCGTC
TCTGCCATATCGCTGTGTGGCTACTGGTGGACGCGCGGCGATAGACGATCGCGATTTACCGGCCGAGCCTACGTT
Transcript >Ophio5|4343
ATGCAGCTTCACGCCATCCTCGCCGCCGTCTTGCACGCCGCTTGCTTCATCGCTGCTCTAGTTGTCTGTGGCCTG
TACGGACACGATCTGCGCGTCGGGTACACGCACGACTCGAAATGGGTCTATGCCATCGTCGTTGGCGGTCTCTCT
GCCGTCACGTGCTTGGTTTATGCCGTGCCCAAGACGCTCCATCGAATCAACGTACCTGCCGCTAGCTGGAGCCTT
GTGCTGTTCATCCTATGGATTGCCGTCTTTGGCGTCTTCGGCTCGATGTACATCAAAAAGGGGTATGGCAATTCT
GAAAGCGACCAACATACTAGACACATGAAGGTGGCCGTGTGGTTCGACCTGGTCAGCGCGCTGCTGTGGCTCGTC
TCTGCCATATCGCTGTGTGGCTACTGGTGGACGCGCGGCGATAGACGATCGCGATTTACCGGCCGAGCCTACGTT
TGA
Gene >Ophio5|4343
ATGCAGCTTCACGCCATCCTCGCCGCCGTCTTGCACGCCGCTTGCTTCATCGCTGCTCTAGTTGTCTGTGGCCTG
TACGGACACGATCTGCGCGTCGGGTACACGCACGACTCGAAATGGGTGAGTGAGGGTGCCATATTTGGGACACGA
TGATGCTCATCAATCGCCTAGGTCTATGCCATCGTCGTTGGCGGTCTCTCTGCCGTCACGTGCTTGGTTTATGCC
GTGCCCAAGACGCTCCATCGAATCAACGTACCTGCCGCTAGCTGGAGCCTTGTGCTGTTCATCCTATGGATTGCC
GTCTTTGGCGTCTTCGGCTCGGTGGGTCAACATCTCATATGTGTTGTGTTGTGTTGTGTGTGTGTGTGTGTGTGT
TTCTCGCCGTGTCGCAAGGCTGATGTGAACGAGCGGCAGATGTACATCAAAAAGGGGTATGGCAATTCTGAAAGC
GACCAACATACTAGACACATGAAGGTGGCCGTGTGGTTCGACCTGGTCAGCGCGCTGCTGTGGCTCGTCTCTGCC
ATATCGCTGTGTGGCTACTGGTGGACGCGCGGCGATAGACGATCGCGATTTACCGGCCGAGCCTACGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail