Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4338
Gene name
Locationscaffold_343:1892..5231
Strand+
Gene length (bp)3339
Transcript length (bp)3270
Coding sequence length (bp)3267
Protein length (aa) 1089

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01764 Lipase_3 Lipase (class 3) 2.6E-15 805 965

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5YLM1|DGLA_RAT Sn1-specific diacylglycerol lipase alpha OS=Rattus norvegicus GN=Dagla PE=1 SV=1 794 968 7.0E-10
sp|Q6WQJ1|DGLA_MOUSE Sn1-specific diacylglycerol lipase alpha OS=Mus musculus GN=Dagla PE=1 SV=2 794 968 7.0E-10
sp|Q9Y4D2|DGLA_HUMAN Sn1-specific diacylglycerol lipase alpha OS=Homo sapiens GN=DAGLA PE=1 SV=3 794 968 3.0E-09
sp|P0C1S9|DGLB_RAT Sn1-specific diacylglycerol lipase beta OS=Rattus norvegicus GN=Daglb PE=1 SV=1 795 970 9.0E-09
sp|Q8NCG7|DGLB_HUMAN Sn1-specific diacylglycerol lipase beta OS=Homo sapiens GN=DAGLB PE=1 SV=2 795 970 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5YLM1|DGLA_RAT Sn1-specific diacylglycerol lipase alpha OS=Rattus norvegicus GN=Dagla PE=1 SV=1 794 968 7.0E-10
sp|Q6WQJ1|DGLA_MOUSE Sn1-specific diacylglycerol lipase alpha OS=Mus musculus GN=Dagla PE=1 SV=2 794 968 7.0E-10
sp|Q9Y4D2|DGLA_HUMAN Sn1-specific diacylglycerol lipase alpha OS=Homo sapiens GN=DAGLA PE=1 SV=3 794 968 3.0E-09
sp|P0C1S9|DGLB_RAT Sn1-specific diacylglycerol lipase beta OS=Rattus norvegicus GN=Daglb PE=1 SV=1 795 970 9.0E-09
sp|Q8NCG7|DGLB_HUMAN Sn1-specific diacylglycerol lipase beta OS=Homo sapiens GN=DAGLB PE=1 SV=2 795 970 1.0E-08
sp|Q91WC9|DGLB_MOUSE Sn1-specific diacylglycerol lipase beta OS=Mus musculus GN=Daglb PE=1 SV=2 795 970 2.0E-08
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 794 969 7.0E-07
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 794 969 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4338
MAAREEPYLDETLPTTTTHRSVSVVPPAPTLLPRPVAQAVSLATRSTGLAIRFGSLVSSYGLDAARFTTLSSLEL
ARGLVEGVLSRAARDTLARSNSDLAAADAETILERSLESLHYAVAQIVFWTSASFRLTGVTLSAASEASQQLLSS
LDQLFGSTDSSRAVASLVTLIRREFSDPATGVGGEKVGVIDLILALSALAYLQRACRTCPAEESRRQACEELIWD
VVVLCDGQRVDVEEDTPSTSFVPLRGSDVSDDNDNEAILTSLKDHVVNSLPPGTAVTISDCVSSVQTITVDVEGS
QLPSLPTPPGAEIIETRGLSPASQRPLTPLSGCAHDPSYRVVYRIQRERFRSTELRHEDETSGPVVIELCDEKPP
AWPASPIDEKPRPSGETLPSTGQHHGGDGDETVKGVVSDRPAATKATTPEKASTVTAPSTSTATTPKTATTPTTA
AGDKPQRPPLRPARVSSSDITANQKKQRLPLGREDTVKADAGKRSQIDVGKRPQIKKKTDTGIASKPAEKKNGLK
HLLKDRGQSVARIWSRDQAEASPTPPKPRPVRKVSGGGVSAVGDKPKSAPPRTSIPAAQRNLALARRPPSQGSVA
TTSTTASAKLLSIQERRRDSVVSLADTFVQHADGGLRPATPTVLRADFSSSGPASPAPYTASLYSMATNNDSQSS
LVLASCYQKSAYHESGALSTLRREGFVDGAFPGGPLLRNMARYMRFSSACYGSHFLRFMGISREVPALGVWDGTH
HDVRHFVHHTESDASSILLASFVDPQGGADASGATGTGVPLVHYISLDHAAKAVVLACRGTLGFEDVMADLACDY
DDLKWRGRRYKVHKGIHASARRLLYGGDGRVLVTIREALLAFPDYGLVLCGHSLGGGVTSLLGVMLARPNPDGPG
FVIAAAPSSRDAAPALEGLRLPPGRRIHVYAYGPPGVMSAALRQITRGLVTSVVHGHDLVPHLSFGLLHDCQALA
HTFKYDESGAKADLRLRLWNALADRWRHRPRAPAEADQLWMLPALQTLRRSLRAVKLLPPGEVFAIESRRVLRRD
AFVLRDGDGAGVGRPAQRVMLSPAEYEDALNMLRLGVIE
Coding >Ophio5|4338
ATGGCCGCTCGCGAGGAGCCTTATCTGGACGAGACCCTACCCACAACGACAACGCACCGTTCAGTCTCCGTTGTC
CCGCCGGCCCCGACGCTTCTGCCGCGCCCCGTCGCCCAGGCTGTCAGTCTAGCGACACGCTCGACGGGCCTCGCT
ATCCGATTCGGCTCGCTCGTCTCATCGTATGGCCTCGATGCTGCCCGCTTCACGACCCTTTCCAGCCTCGAGCTA
GCCCGCGGCCTGGTAGAGGGCGTCCTCAGCCGCGCCGCGCGGGATACGCTGGCCCGCTCCAACTCGGACCTCGCC
GCCGCCGATGCTGAGACGATTCTCGAGCGCAGCCTCGAGAGCTTGCACTATGCCGTCGCTCAGATCGTCTTCTGG
ACTTCGGCCAGCTTTCGTCTAACGGGCGTTACCCTCTCCGCTGCCAGCGAGGCCTCGCAGCAGCTGCTGTCGTCT
CTCGACCAGCTCTTCGGCTCGACCGACTCTTCCCGCGCCGTCGCCAGCCTCGTCACCCTCATCCGCCGCGAGTTC
AGTGATCCGGCGACAGGCGTTGGCGGCGAAAAGGTCGGCGTCATCGACCTCATACTCGCTCTCAGCGCCCTGGCC
TACCTCCAGCGTGCCTGTCGCACATGCCCCGCCGAGGAGAGCCGACGCCAGGCGTGCGAAGAGCTCATCTGGGAC
GTCGTTGTCCTCTGCGACGGCCAGCGCGTTGATGTTGAAGAGGACACGCCGTCGACATCGTTCGTGCCTCTCCGA
GGGTCAGACGTCAGCGACGACAACGACAACGAGGCCATCCTCACCAGTCTCAAGGACCACGTCGTCAACTCGCTA
CCTCCGGGCACCGCTGTCACCATCTCTGACTGCGTATCCTCGGTGCAGACCATCACCGTCGACGTCGAGGGCTCT
CAGCTGCCGTCGCTGCCGACGCCCCCTGGCGCCGAGATAATCGAGACGCGGGGGCTGTCGCCTGCAAGCCAACGG
CCGCTGACGCCTCTGTCTGGCTGCGCGCACGACCCGTCGTATCGTGTCGTCTACAGGATTCAGCGTGAGCGGTTC
CGGTCGACGGAGCTGCGGCACGAGGACGAGACGTCTGGACCGGTCGTCATCGAGCTGTGTGACGAAAAGCCGCCC
GCATGGCCAGCGAGCCCGATTGATGAGAAGCCGAGGCCGTCGGGCGAGACTCTGCCGTCGACAGGCCAGCACCAT
GGAGGCGACGGCGACGAGACAGTCAAGGGGGTTGTCTCGGATCGGCCCGCGGCCACGAAGGCTACGACGCCTGAG
AAGGCCTCTACCGTCACCGCGCCTTCGACATCTACGGCCACGACGCCAAAAACGGCCACGACGCCTACGACAGCC
GCCGGCGACAAGCCTCAACGACCGCCGCTACGGCCGGCACGAGTCTCGTCTTCCGATATTACAGCGAACCAAAAG
AAGCAGCGCTTGCCGCTCGGGCGCGAGGACACGGTCAAGGCGGATGCCGGCAAGCGCTCTCAGATAGATGTTGGC
AAACGCCCCCAAATCAAGAAGAAGACGGACACAGGCATAGCGTCAAAGCCGGCAGAGAAGAAGAACGGACTGAAG
CACCTCCTCAAGGACAGGGGCCAGTCTGTGGCCAGGATCTGGAGTAGGGACCAGGCCGAGGCAAGCCCAACGCCA
CCAAAGCCACGGCCGGTCCGTAAAGTCTCCGGCGGCGGCGTGTCGGCGGTTGGCGACAAGCCGAAGTCGGCCCCG
CCTAGAACCTCGATTCCAGCGGCGCAGCGAAACCTGGCCTTGGCTCGTCGGCCGCCATCTCAGGGGTCGGTTGCC
ACAACCAGCACGACGGCCAGCGCCAAGTTGTTGTCGATACAGGAACGACGGCGCGACTCGGTCGTCTCGCTGGCC
GACACCTTCGTCCAGCACGCCGACGGGGGGCTCCGACCGGCGACGCCGACGGTGCTTCGGGCCGACTTCTCCAGC
AGCGGGCCGGCATCGCCAGCGCCGTACACGGCCAGCCTTTACAGCATGGCCACGAACAACGACTCGCAGTCGTCG
CTGGTGTTGGCGTCGTGCTACCAGAAGAGCGCCTATCACGAGTCCGGGGCACTCAGCACACTGCGGCGCGAGGGC
TTCGTTGACGGCGCGTTCCCCGGTGGGCCGCTGCTGCGCAACATGGCACGCTACATGCGCTTCTCGTCGGCCTGT
TACGGCTCGCATTTCCTGCGCTTCATGGGCATCTCGCGCGAGGTGCCGGCGCTCGGCGTCTGGGACGGCACTCAC
CACGACGTGAGGCATTTTGTTCACCACACTGAGAGCGATGCTAGCAGCATCCTGCTGGCGTCATTTGTCGATCCA
CAGGGCGGCGCAGACGCGTCTGGCGCGACAGGCACGGGCGTGCCGCTGGTACACTACATCTCTCTCGATCATGCG
GCCAAGGCCGTGGTACTGGCCTGTCGCGGCACGCTGGGCTTCGAGGACGTCATGGCCGACCTGGCCTGCGATTAC
GACGATCTCAAGTGGCGCGGCCGCCGGTACAAGGTGCACAAGGGCATCCACGCGTCTGCGCGTCGGTTGCTGTAT
GGAGGCGACGGACGCGTCCTCGTCACCATCCGCGAGGCGCTGCTGGCCTTTCCCGACTATGGCCTCGTGCTGTGC
GGCCACTCGCTCGGAGGCGGCGTCACCTCGCTACTGGGCGTCATGCTGGCCCGGCCTAACCCGGACGGACCGGGC
TTCGTCATCGCCGCCGCGCCTTCGAGCCGCGATGCCGCGCCTGCGCTCGAAGGCCTACGACTCCCTCCCGGCCGA
CGAATCCACGTCTACGCCTACGGCCCGCCGGGCGTCATGTCTGCGGCGCTACGTCAAATCACGCGCGGCCTCGTC
ACCAGCGTCGTCCACGGCCACGACCTCGTCCCCCACCTCTCATTCGGCCTCCTTCACGACTGCCAAGCGCTGGCG
CACACCTTCAAGTACGATGAGAGCGGCGCGAAAGCCGACCTGCGTCTCCGACTGTGGAACGCCCTCGCCGACCGT
TGGAGGCATCGGCCCCGAGCGCCGGCCGAGGCGGATCAGCTGTGGATGCTGCCGGCGCTGCAGACGCTGCGGCGG
TCCCTCCGCGCCGTGAAGCTGCTCCCGCCCGGGGAGGTGTTTGCCATCGAGAGCCGTCGCGTGCTGCGTCGCGAC
GCTTTTGTCCTTCGCGACGGTGACGGGGCTGGCGTTGGACGGCCGGCCCAGAGGGTCATGCTCAGCCCCGCCGAG
TACGAGGATGCGCTGAATATGTTGCGGTTGGGGGTTATTGAG
Transcript >Ophio5|4338
ATGGCCGCTCGCGAGGAGCCTTATCTGGACGAGACCCTACCCACAACGACAACGCACCGTTCAGTCTCCGTTGTC
CCGCCGGCCCCGACGCTTCTGCCGCGCCCCGTCGCCCAGGCTGTCAGTCTAGCGACACGCTCGACGGGCCTCGCT
ATCCGATTCGGCTCGCTCGTCTCATCGTATGGCCTCGATGCTGCCCGCTTCACGACCCTTTCCAGCCTCGAGCTA
GCCCGCGGCCTGGTAGAGGGCGTCCTCAGCCGCGCCGCGCGGGATACGCTGGCCCGCTCCAACTCGGACCTCGCC
GCCGCCGATGCTGAGACGATTCTCGAGCGCAGCCTCGAGAGCTTGCACTATGCCGTCGCTCAGATCGTCTTCTGG
ACTTCGGCCAGCTTTCGTCTAACGGGCGTTACCCTCTCCGCTGCCAGCGAGGCCTCGCAGCAGCTGCTGTCGTCT
CTCGACCAGCTCTTCGGCTCGACCGACTCTTCCCGCGCCGTCGCCAGCCTCGTCACCCTCATCCGCCGCGAGTTC
AGTGATCCGGCGACAGGCGTTGGCGGCGAAAAGGTCGGCGTCATCGACCTCATACTCGCTCTCAGCGCCCTGGCC
TACCTCCAGCGTGCCTGTCGCACATGCCCCGCCGAGGAGAGCCGACGCCAGGCGTGCGAAGAGCTCATCTGGGAC
GTCGTTGTCCTCTGCGACGGCCAGCGCGTTGATGTTGAAGAGGACACGCCGTCGACATCGTTCGTGCCTCTCCGA
GGGTCAGACGTCAGCGACGACAACGACAACGAGGCCATCCTCACCAGTCTCAAGGACCACGTCGTCAACTCGCTA
CCTCCGGGCACCGCTGTCACCATCTCTGACTGCGTATCCTCGGTGCAGACCATCACCGTCGACGTCGAGGGCTCT
CAGCTGCCGTCGCTGCCGACGCCCCCTGGCGCCGAGATAATCGAGACGCGGGGGCTGTCGCCTGCAAGCCAACGG
CCGCTGACGCCTCTGTCTGGCTGCGCGCACGACCCGTCGTATCGTGTCGTCTACAGGATTCAGCGTGAGCGGTTC
CGGTCGACGGAGCTGCGGCACGAGGACGAGACGTCTGGACCGGTCGTCATCGAGCTGTGTGACGAAAAGCCGCCC
GCATGGCCAGCGAGCCCGATTGATGAGAAGCCGAGGCCGTCGGGCGAGACTCTGCCGTCGACAGGCCAGCACCAT
GGAGGCGACGGCGACGAGACAGTCAAGGGGGTTGTCTCGGATCGGCCCGCGGCCACGAAGGCTACGACGCCTGAG
AAGGCCTCTACCGTCACCGCGCCTTCGACATCTACGGCCACGACGCCAAAAACGGCCACGACGCCTACGACAGCC
GCCGGCGACAAGCCTCAACGACCGCCGCTACGGCCGGCACGAGTCTCGTCTTCCGATATTACAGCGAACCAAAAG
AAGCAGCGCTTGCCGCTCGGGCGCGAGGACACGGTCAAGGCGGATGCCGGCAAGCGCTCTCAGATAGATGTTGGC
AAACGCCCCCAAATCAAGAAGAAGACGGACACAGGCATAGCGTCAAAGCCGGCAGAGAAGAAGAACGGACTGAAG
CACCTCCTCAAGGACAGGGGCCAGTCTGTGGCCAGGATCTGGAGTAGGGACCAGGCCGAGGCAAGCCCAACGCCA
CCAAAGCCACGGCCGGTCCGTAAAGTCTCCGGCGGCGGCGTGTCGGCGGTTGGCGACAAGCCGAAGTCGGCCCCG
CCTAGAACCTCGATTCCAGCGGCGCAGCGAAACCTGGCCTTGGCTCGTCGGCCGCCATCTCAGGGGTCGGTTGCC
ACAACCAGCACGACGGCCAGCGCCAAGTTGTTGTCGATACAGGAACGACGGCGCGACTCGGTCGTCTCGCTGGCC
GACACCTTCGTCCAGCACGCCGACGGGGGGCTCCGACCGGCGACGCCGACGGTGCTTCGGGCCGACTTCTCCAGC
AGCGGGCCGGCATCGCCAGCGCCGTACACGGCCAGCCTTTACAGCATGGCCACGAACAACGACTCGCAGTCGTCG
CTGGTGTTGGCGTCGTGCTACCAGAAGAGCGCCTATCACGAGTCCGGGGCACTCAGCACACTGCGGCGCGAGGGC
TTCGTTGACGGCGCGTTCCCCGGTGGGCCGCTGCTGCGCAACATGGCACGCTACATGCGCTTCTCGTCGGCCTGT
TACGGCTCGCATTTCCTGCGCTTCATGGGCATCTCGCGCGAGGTGCCGGCGCTCGGCGTCTGGGACGGCACTCAC
CACGACGTGAGGCATTTTGTTCACCACACTGAGAGCGATGCTAGCAGCATCCTGCTGGCGTCATTTGTCGATCCA
CAGGGCGGCGCAGACGCGTCTGGCGCGACAGGCACGGGCGTGCCGCTGGTACACTACATCTCTCTCGATCATGCG
GCCAAGGCCGTGGTACTGGCCTGTCGCGGCACGCTGGGCTTCGAGGACGTCATGGCCGACCTGGCCTGCGATTAC
GACGATCTCAAGTGGCGCGGCCGCCGGTACAAGGTGCACAAGGGCATCCACGCGTCTGCGCGTCGGTTGCTGTAT
GGAGGCGACGGACGCGTCCTCGTCACCATCCGCGAGGCGCTGCTGGCCTTTCCCGACTATGGCCTCGTGCTGTGC
GGCCACTCGCTCGGAGGCGGCGTCACCTCGCTACTGGGCGTCATGCTGGCCCGGCCTAACCCGGACGGACCGGGC
TTCGTCATCGCCGCCGCGCCTTCGAGCCGCGATGCCGCGCCTGCGCTCGAAGGCCTACGACTCCCTCCCGGCCGA
CGAATCCACGTCTACGCCTACGGCCCGCCGGGCGTCATGTCTGCGGCGCTACGTCAAATCACGCGCGGCCTCGTC
ACCAGCGTCGTCCACGGCCACGACCTCGTCCCCCACCTCTCATTCGGCCTCCTTCACGACTGCCAAGCGCTGGCG
CACACCTTCAAGTACGATGAGAGCGGCGCGAAAGCCGACCTGCGTCTCCGACTGTGGAACGCCCTCGCCGACCGT
TGGAGGCATCGGCCCCGAGCGCCGGCCGAGGCGGATCAGCTGTGGATGCTGCCGGCGCTGCAGACGCTGCGGCGG
TCCCTCCGCGCCGTGAAGCTGCTCCCGCCCGGGGAGGTGTTTGCCATCGAGAGCCGTCGCGTGCTGCGTCGCGAC
GCTTTTGTCCTTCGCGACGGTGACGGGGCTGGCGTTGGACGGCCGGCCCAGAGGGTCATGCTCAGCCCCGCCGAG
TACGAGGATGCGCTGAATATGTTGCGGTTGGGGGTTATTGAGTAG
Gene >Ophio5|4338
ATGGCCGCTCGCGAGGAGCCTTATCTGGACGAGACCCTACCCACAACGACAACGCACCGTTCAGTCTCCGTTGTC
CCGCCGGCCCCGACGCTTCTGCCGCGCCCCGTCGCCCAGGCTGTCAGTCTAGCGACACGCTCGACGGGCCTCGCT
ATCCGATTCGGCTCGCTCGTCTCATCGTATGGCCTCGATGCTGCCCGCTTCACGACCCTTTCCAGCCTCGAGCTA
GCCCGCGGCCTGGTAGAGGGCGTCCTCAGCCGCGCCGCGCGGGATACGCTGGCCCGCTCCAACTCGGACCTCGCC
GCCGCCGATGCTGAGACGATTCTCGAGCGCAGCCTCGAGAGCTTGCACTATGCCGTCGCTCAGATCGTCTTCTGG
ACTTCGGCCAGCTTTCGTCTAACGGGCGTTACCCTCTCCGCTGCCAGCGAGGCCTCGCAGCAGCTGCTGTCGTCT
CTCGACCAGCTCTTCGGCTCGACCGACTCTTCCCGCGCCGTCGCCAGCCTCGTCACCCTCATCCGCCGCGAGTTC
AGTGATCCGGCGACAGGCGTTGGCGGCGAAAAGGTCGGCGTCATCGACCTCATACTCGCTCTCAGCGCCCTGGCC
TACCTCCAGCGTGCCTGTCGCACATGCCCCGCCGAGGAGAGCCGACGCCAGGCGTGCGAAGAGCTCATCTGGGAC
GTCGTTGTCCTCTGCGACGGCCAGCGCGTTGATGTTGAAGAGGACACGCCGTCGACATCGTTCGTGCCTCTCCGA
GGGTCAGACGTCAGCGACGACAACGACAACGAGGCCATCCTCACCAGTCTCAAGGACCACGTCGTCAACTCGCTA
CCTCCGGGCACCGCTGTCACCATCTCTGACTGCGTATCCTCGGTGCAGACCATCACCGTCGACGTCGAGGGCTCT
CAGCTGCCGTCGCTGCCGACGCCCCCTGGCGCCGAGATAATCGAGACGCGGGGGCTGTCGCCTGCAAGCCAACGG
CCGCTGACGCCTCTGTCTGGCTGCGCGCACGACCCGTCGTATCGTGTCGTCTACAGGATTCAGCGTGAGCGGTTC
CGGTCGACGGAGCTGCGGCACGAGGACGAGACGTCTGGACCGGTCGTCATCGAGCTGTGTGACGAAAAGCCGCCC
GCATGGCCAGCGAGCCCGATTGATGAGAAGCCGAGGCCGTCGGGCGAGACTCTGCCGTCGACAGGCCAGCACCAT
GGAGGCGACGGCGACGAGACAGTCAAGGGGGTTGTCTCGGATCGGCCCGCGGCCACGAAGGCTACGACGCCTGAG
AAGGCCTCTACCGTCACCGCGCCTTCGACATCTACGGCCACGACGCCAAAAACGGCCACGACGCCTACGACAGCC
GCCGGCGACAAGCCTCAACGACCGCCGCTACGGCCGGCACGAGTCTCGTCTTCCGATATTACAGCGAACCAAAAG
AAGCAGCGCTTGCCGCTCGGGCGCGAGGACACGGTCAAGGCGGATGCCGGCAAGCGCTCTCAGATAGATGTTGGC
AAACGCCCCCAAATCAAGAAGAAGACGGACACAGGCATAGCGTCAAAGCCGGCAGAGAAGAAGAACGGACTGAAG
CACCTCCTCAAGGACAGGGGCCAGTCTGTGGCCAGGATCTGGAGTAGGGACCAGGCCGAGGCAAGCCCAACGCCA
CCAAAGCCACGGCCGGTCCGTAAAGTCTCCGGCGGCGGCGTGTCGGCGGTTGGCGACAAGCCGAAGTCGGCCCCG
CCTAGAACCTCGATTCCAGCGGCGCAGCGAAACCTGGCCTTGGCTCGTCGGCCGCCATCTCAGGGGTCGGTTGCC
ACAACCAGCACGACGGCCAGCGCCAAGTTGTTGTCGATACAGGAACGACGGCGCGACTCGGTCGTCTCGCTGGCC
GACACCTTCGTCCAGCACGCCGACGGGGGGCTCCGACCGGCGACGCCGACGGTGCTTCGGGCCGACTTCTCCAGC
AGCGGGCCGGCATCGCCAGCGCCGTACACGGCCAGCCTTTACAGCATGGCCACGAACAACGACTCGCAGTCGTCG
CTGGTGTTGGCGTCGTGCTACCAGAAGAGCGCCTATCACGAGTCCGGGGCACTCAGCACACTGCGGCGCGAGGGC
TTCGTTGACGGCGCGTTCCCCGGTGGGCCGCTGCTGCGCAACATGGCACGCTACATGCGCTTCTCGTCGGCCTGT
TACGGCTCGCATTTCCTGCGCTTCATGGGCATCTCGCGCGAGGTGCCGGCGCTCGGCGTCTGGGACGGCACTCAC
CACGACGTGAGGCATTTTGTTCACCACACTGAGAGCGATGCTAGCAGCATCCTGCTGGCGTCATTTGTCGATCCA
CAGGGCGGCGCAGACGCGTCTGGCGCGACAGGCACGGGCGTGCCGCTGGTACACTACATCTCTCTCGATCATGCG
GCCAAGGCCGTGGTACTGGCCTGTCGCGGCACGCTGGGCTTCGAGGACGTCATGGCCGACCTGGCCTGCGATTAC
GACGATCTCAAGTGGCGCGGCCGCCGGTACAAGGTGCACAAGGGCATCCACGCGTCTGCGCGTCGGTTGCTGTAT
GGAGGCGACGGACGCGTCCTCGTCACCATCCGCGAGGCGCTGCTGGCCTTTCCCGACTATGGCCTCGTGCTGTGC
GGCCACTCGCTCGGAGGCGGCGTCACCTCGCTACTGGGCGTCATGCTGGCCCGGCCTAACCCGGACGGACCGGGC
TTCGTCATCGCCGCCGCGCCTTCGAGCCGCGATGCCGCGCCTGCGCTCGAAGGCCTACGACTCCCTCCCGGCCGA
CGAATCCACGTCTACGCCTACGGCCCGCCGGGCGTCATGTCTGCGGCGCTACGTCAAATCACGCGCGGCCTCGTC
ACCAGCGTCGTCCACGGCCACGACCTCGTCCCCCACCTCTCATTCGGCCTCCTTCACGACTGCCAAGCGCTGGCG
CACACCTTCAAGTACGATGAGAGCGGCGCGAAAGCCGACCTGCGTCTCCGACTGTGGAACGCCCTCGCCGACCGT
TGGAGGCATCGGCCCCGAGCGCCGGCCGAGGCGGATCAGCTGTGGATGCTGCCGGCGCTGCAGACGCTGCGGCGG
TCCCTCCGCGCCGTGAAGCTGCTCCCGCCCGGGGAGGTGTTTGCCATCGAGAGCCGTCGCGTGCTGCGTCGCGAC
GCTTTTGTCCTTCGCGACGGTGACGGGGCTGGCGTTGGACGGCCGGCCCAGAGGGTCATGCTCAGGTATATCCGT
GACGTGGAGGCGCGCTTTGGCGAGATTCGTTTCGGGACGAGCATGTTGACGGATCATAGCCCCGCCGAGTACGAG
GATGCGCTGAATATGTTGCGGTTGGGGGTTATTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail