Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4334
Gene name
Locationscaffold_342:12991..16312
Strand-
Gene length (bp)3321
Transcript length (bp)3105
Coding sequence length (bp)3102
Protein length (aa) 1034

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07217 Het-C Heterokaryon incompatibility protein Het-C 3.3E-238 13 569

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q01133|FMRA_CALPA Antho-RFamide neuropeptides OS=Calliactis parasitica PE=1 SV=1 761 941 6.0E-09
sp|Q01133|FMRA_CALPA Antho-RFamide neuropeptides OS=Calliactis parasitica PE=1 SV=1 784 1003 4.0E-08
sp|O51741|IF2_BORBU Translation initiation factor IF-2 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=infB PE=3 SV=1 761 912 3.0E-07
sp|O51741|IF2_BORBU Translation initiation factor IF-2 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=infB PE=3 SV=1 789 936 1.0E-06
sp|Q65ZX2|IF2_BORBP Translation initiation factor IF-2 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=infB PE=3 SV=1 777 939 3.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q01133|FMRA_CALPA Antho-RFamide neuropeptides OS=Calliactis parasitica PE=1 SV=1 761 941 6.0E-09
sp|Q01133|FMRA_CALPA Antho-RFamide neuropeptides OS=Calliactis parasitica PE=1 SV=1 784 1003 4.0E-08
sp|O51741|IF2_BORBU Translation initiation factor IF-2 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=infB PE=3 SV=1 761 912 3.0E-07
sp|O51741|IF2_BORBU Translation initiation factor IF-2 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=infB PE=3 SV=1 789 936 1.0E-06
sp|Q65ZX2|IF2_BORBP Translation initiation factor IF-2 OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=infB PE=3 SV=1 777 939 3.0E-06
sp|Q16994|FMR2_ANTEL Antho-RFamide neuropeptides type 2 OS=Anthopleura elegantissima PE=1 SV=1 761 906 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4334
MPDLRNSGPILGLVILVALIGPAAAFGAGNIASISKLEGQNWRHGDIEDALLTLAMAQAMKGKKFTKIMVARVYF
GNWLRDYSQAIDVGTVKSVSAEAIRLLLCVLGFLTFGYGSGEFEVTADRVGCYRPEDHIDNPKNYADNQDARQYD
RRLRGPIDEERELSIDPHTGMKNYIANERSGIMTSAQHVRRLFGGCIELGRRYKENGDKNDLYESLRLMGTGLHC
LEDFFAHSNYTELALIEMGETEVFPHCGQDTLLQLEGARQPVYPIVTGTFGGVDFLHSVVGEVSDKLSQNEIDEL
EGALQESKNSDTSMLRDLLDKIPDGLLGGKKQTDKIDEIQSNASAAQLQGMSVSPRQPEEFTAYVTQVYGQVMPA
IKFHDDIMKAITGAIENIPVLPKVIEQLEEQLSKFVFSIMAPFVVPLIQQIRNELRTGSDEIVHSSQQEQHVVFE
DDRCSDPTHSMLSKDHFSNILNEIAGRTAAKMLHWVVPQLMDAIDDDSVDVNRLLNRIIYGVMHHPAQREMGQDG
VAEARQLMYGCVQEWWGEISDEQRNDYRRKLSRDGVQNGENHKEGVNDTGHGHGCVGKLKMRKLYGEQDTLENRI
AGAAANAIFQGATGALSGVVEQNTGIKLPSAQGSQQQQAEERKEEGGFGGFLGSLLGGAFGKSNSESHSSQRRED
DGSVTQTQTEYGRQGQHYGQAEYSQTQRPDGSSESQYSRFEQQESQGGRQTAGYGYEERTETRPAHGGGYEQRTE
RQEYRGYGQGGGYGRESQSSGGYGQESYGRHNQAGGYGRENQSSGGYGQESQSGGGYGQESYGRHNQAGGYGREN
QSSGGYGQESQSGGGYGRESQSSGYGQESYGRHNQAGGYGRESQSSGGYGRESFGRESESSGYGQDSGYGRGNQS
GTYGRESESSGYGRDSGYGRQNEDSDSGNGGYGKPRGGYGRRDDDSDDNGGGRHGRGHGGGHGRRADDSSGDDGG
RGGYGQGGGGYSQGGGGYGGGGGQGRRGYGGRRDKDDDDDDDSSSNSGNGRRGQGRHGY
Coding >Ophio5|4334
ATGCCTGACCTTAGAAACAGCGGCCCAATCCTGGGCCTCGTCATCCTCGTCGCCTTGATTGGTCCTGCCGCGGCC
TTTGGTGCTGGGAATATCGCCTCCATCTCCAAGCTCGAAGGCCAGAACTGGCGACATGGCGACATCGAGGACGCA
CTTCTCACACTGGCCATGGCACAGGCCATGAAGGGCAAGAAGTTTACCAAGATCATGGTCGCTCGCGTCTATTTC
GGCAACTGGCTGCGCGACTACTCCCAGGCTATCGACGTCGGCACCGTCAAGTCCGTCTCCGCCGAGGCCATCCGC
CTTCTTCTCTGCGTCCTCGGCTTCCTCACCTTTGGCTACGGCTCGGGCGAGTTCGAAGTGACGGCCGACCGTGTC
GGATGCTACCGCCCGGAGGATCACATCGACAACCCAAAGAACTATGCCGACAACCAGGACGCACGACAGTACGAC
CGCCGCCTCCGCGGCCCTATCGACGAGGAGAGGGAGCTCTCCATCGATCCCCACACCGGCATGAAGAACTACATT
GCCAACGAGCGTTCCGGCATCATGACCTCTGCCCAGCACGTTAGGAGGCTCTTTGGCGGCTGCATCGAGCTCGGC
CGCCGATACAAGGAGAATGGCGATAAGAACGACCTTTACGAGTCGCTCCGCCTCATGGGCACTGGCCTTCACTGC
CTCGAAGACTTTTTCGCTCACAGCAACTACACTGAGCTCGCATTGATCGAGATGGGCGAGACTGAAGTCTTTCCT
CACTGTGGACAAGACACCCTCTTGCAACTCGAGGGCGCCCGCCAACCTGTCTACCCCATTGTTACCGGCACCTTT
GGCGGCGTGGATTTCCTCCACTCTGTCGTGGGCGAAGTCTCGGACAAGTTGTCCCAGAACGAAATCGACGAGCTC
GAAGGGGCGCTGCAGGAGAGCAAGAACTCCGACACCAGCATGCTCCGCGATCTTCTTGACAAGATACCCGATGGT
CTACTCGGCGGCAAGAAGCAGACGGACAAGATCGACGAGATTCAGTCCAATGCGTCGGCGGCCCAACTCCAGGGC
ATGTCCGTTTCACCGCGGCAACCGGAAGAGTTTACGGCGTATGTCACCCAAGTCTATGGCCAGGTGATGCCGGCC
ATCAAGTTCCACGACGACATCATGAAGGCCATCACGGGCGCCATCGAGAATATTCCTGTGCTGCCCAAGGTCATC
GAGCAGCTGGAGGAGCAGCTGTCCAAGTTTGTCTTCTCCATCATGGCCCCTTTCGTGGTTCCCCTGATCCAGCAG
ATCCGAAACGAGCTGCGGACCGGATCCGACGAGATTGTCCACAGCAGCCAGCAGGAGCAGCACGTTGTCTTTGAG
GACGACCGGTGCAGCGACCCGACTCACTCGATGCTCTCCAAGGACCACTTCTCCAACATCTTGAACGAGATCGCC
GGCCGAACAGCGGCCAAGATGCTGCACTGGGTGGTCCCTCAACTCATGGACGCCATCGACGACGACAGCGTCGAC
GTGAACCGTCTGCTGAACCGCATCATCTACGGCGTCATGCACCACCCAGCTCAGCGGGAGATGGGACAGGACGGC
GTTGCCGAGGCTCGACAGCTCATGTACGGCTGTGTGCAGGAGTGGTGGGGTGAGATCAGCGACGAGCAAAGGAAC
GACTACCGGCGAAAGCTGTCCCGCGATGGCGTCCAGAACGGAGAAAATCACAAGGAGGGTGTCAACGATACGGGC
CACGGCCACGGATGCGTGGGTAAGCTGAAGATGCGCAAGCTCTACGGCGAGCAAGACACGCTCGAGAACAGGATC
GCGGGCGCGGCTGCCAACGCCATCTTCCAGGGCGCTACGGGGGCCCTCTCGGGAGTGGTAGAGCAGAACACGGGC
ATCAAGCTGCCGTCGGCGCAGGGCTCGCAGCAGCAGCAGGCCGAGGAGCGCAAGGAGGAGGGCGGCTTCGGCGGC
TTCCTGGGCTCCCTCCTGGGCGGCGCCTTTGGGAAGAGCAACAGCGAGTCGCACAGCAGCCAGCGGCGGGAGGAC
GACGGCTCGGTGACGCAGACGCAGACGGAGTACGGTCGGCAGGGCCAGCACTACGGCCAGGCCGAGTACAGCCAG
ACGCAGCGTCCGGACGGCAGCAGCGAGTCCCAGTACAGCCGGTTCGAACAGCAGGAGTCGCAGGGCGGGCGGCAG
ACGGCGGGCTACGGCTACGAGGAGAGGACGGAGACGCGGCCGGCGCACGGCGGCGGGTACGAGCAGCGGACCGAG
AGGCAGGAGTACAGGGGCTACGGCCAGGGCGGCGGCTACGGACGAGAGAGCCAGAGCAGTGGTGGCTACGGACAA
GAGAGCTACGGCCGCCACAACCAAGCCGGTGGTTACGGACGAGAGAACCAGAGCAGTGGCGGCTACGGACAAGAG
AGCCAGAGCGGTGGTGGCTATGGACAAGAGAGCTACGGCCGCCACAACCAAGCCGGTGGTTACGGACGAGAGAAC
CAGAGCAGTGGCGGCTACGGACAGGAGAGCCAGAGCGGTGGTGGCTATGGACGAGAGAGCCAGAGCAGTGGTTAT
GGACAAGAGAGCTACGGGCGCCACAACCAAGCTGGTGGCTACGGACGAGAAAGCCAGAGCAGTGGTGGCTACGGA
CGGGAGAGCTTCGGACGAGAGAGCGAGAGCAGCGGCTACGGTCAGGATAGCGGCTACGGTCGCGGGAACCAGAGC
GGCACTTATGGCCGCGAAAGCGAGAGCAGTGGCTACGGTCGTGACAGCGGCTACGGCCGGCAAAACGAGGACAGC
GACAGCGGCAACGGAGGGTACGGGAAACCGAGAGGAGGCTACGGCCGACGGGACGACGACAGCGACGACAACGGC
GGTGGACGACACGGGCGCGGACATGGCGGCGGACATGGACGGCGGGCCGATGACAGCTCGGGCGACGACGGCGGA
CGAGGCGGCTACGGCCAGGGGGGAGGCGGTTATAGTCAGGGAGGGGGCGGCTACGGAGGCGGCGGAGGCCAGGGA
CGGCGCGGCTACGGCGGCCGGAGAGACAAAGATGACGACGACGACGACGACTCGTCGTCCAACTCGGGCAACGGC
CGGCGCGGACAGGGCCGACATGGATAC
Transcript >Ophio5|4334
ATGCCTGACCTTAGAAACAGCGGCCCAATCCTGGGCCTCGTCATCCTCGTCGCCTTGATTGGTCCTGCCGCGGCC
TTTGGTGCTGGGAATATCGCCTCCATCTCCAAGCTCGAAGGCCAGAACTGGCGACATGGCGACATCGAGGACGCA
CTTCTCACACTGGCCATGGCACAGGCCATGAAGGGCAAGAAGTTTACCAAGATCATGGTCGCTCGCGTCTATTTC
GGCAACTGGCTGCGCGACTACTCCCAGGCTATCGACGTCGGCACCGTCAAGTCCGTCTCCGCCGAGGCCATCCGC
CTTCTTCTCTGCGTCCTCGGCTTCCTCACCTTTGGCTACGGCTCGGGCGAGTTCGAAGTGACGGCCGACCGTGTC
GGATGCTACCGCCCGGAGGATCACATCGACAACCCAAAGAACTATGCCGACAACCAGGACGCACGACAGTACGAC
CGCCGCCTCCGCGGCCCTATCGACGAGGAGAGGGAGCTCTCCATCGATCCCCACACCGGCATGAAGAACTACATT
GCCAACGAGCGTTCCGGCATCATGACCTCTGCCCAGCACGTTAGGAGGCTCTTTGGCGGCTGCATCGAGCTCGGC
CGCCGATACAAGGAGAATGGCGATAAGAACGACCTTTACGAGTCGCTCCGCCTCATGGGCACTGGCCTTCACTGC
CTCGAAGACTTTTTCGCTCACAGCAACTACACTGAGCTCGCATTGATCGAGATGGGCGAGACTGAAGTCTTTCCT
CACTGTGGACAAGACACCCTCTTGCAACTCGAGGGCGCCCGCCAACCTGTCTACCCCATTGTTACCGGCACCTTT
GGCGGCGTGGATTTCCTCCACTCTGTCGTGGGCGAAGTCTCGGACAAGTTGTCCCAGAACGAAATCGACGAGCTC
GAAGGGGCGCTGCAGGAGAGCAAGAACTCCGACACCAGCATGCTCCGCGATCTTCTTGACAAGATACCCGATGGT
CTACTCGGCGGCAAGAAGCAGACGGACAAGATCGACGAGATTCAGTCCAATGCGTCGGCGGCCCAACTCCAGGGC
ATGTCCGTTTCACCGCGGCAACCGGAAGAGTTTACGGCGTATGTCACCCAAGTCTATGGCCAGGTGATGCCGGCC
ATCAAGTTCCACGACGACATCATGAAGGCCATCACGGGCGCCATCGAGAATATTCCTGTGCTGCCCAAGGTCATC
GAGCAGCTGGAGGAGCAGCTGTCCAAGTTTGTCTTCTCCATCATGGCCCCTTTCGTGGTTCCCCTGATCCAGCAG
ATCCGAAACGAGCTGCGGACCGGATCCGACGAGATTGTCCACAGCAGCCAGCAGGAGCAGCACGTTGTCTTTGAG
GACGACCGGTGCAGCGACCCGACTCACTCGATGCTCTCCAAGGACCACTTCTCCAACATCTTGAACGAGATCGCC
GGCCGAACAGCGGCCAAGATGCTGCACTGGGTGGTCCCTCAACTCATGGACGCCATCGACGACGACAGCGTCGAC
GTGAACCGTCTGCTGAACCGCATCATCTACGGCGTCATGCACCACCCAGCTCAGCGGGAGATGGGACAGGACGGC
GTTGCCGAGGCTCGACAGCTCATGTACGGCTGTGTGCAGGAGTGGTGGGGTGAGATCAGCGACGAGCAAAGGAAC
GACTACCGGCGAAAGCTGTCCCGCGATGGCGTCCAGAACGGAGAAAATCACAAGGAGGGTGTCAACGATACGGGC
CACGGCCACGGATGCGTGGGTAAGCTGAAGATGCGCAAGCTCTACGGCGAGCAAGACACGCTCGAGAACAGGATC
GCGGGCGCGGCTGCCAACGCCATCTTCCAGGGCGCTACGGGGGCCCTCTCGGGAGTGGTAGAGCAGAACACGGGC
ATCAAGCTGCCGTCGGCGCAGGGCTCGCAGCAGCAGCAGGCCGAGGAGCGCAAGGAGGAGGGCGGCTTCGGCGGC
TTCCTGGGCTCCCTCCTGGGCGGCGCCTTTGGGAAGAGCAACAGCGAGTCGCACAGCAGCCAGCGGCGGGAGGAC
GACGGCTCGGTGACGCAGACGCAGACGGAGTACGGTCGGCAGGGCCAGCACTACGGCCAGGCCGAGTACAGCCAG
ACGCAGCGTCCGGACGGCAGCAGCGAGTCCCAGTACAGCCGGTTCGAACAGCAGGAGTCGCAGGGCGGGCGGCAG
ACGGCGGGCTACGGCTACGAGGAGAGGACGGAGACGCGGCCGGCGCACGGCGGCGGGTACGAGCAGCGGACCGAG
AGGCAGGAGTACAGGGGCTACGGCCAGGGCGGCGGCTACGGACGAGAGAGCCAGAGCAGTGGTGGCTACGGACAA
GAGAGCTACGGCCGCCACAACCAAGCCGGTGGTTACGGACGAGAGAACCAGAGCAGTGGCGGCTACGGACAAGAG
AGCCAGAGCGGTGGTGGCTATGGACAAGAGAGCTACGGCCGCCACAACCAAGCCGGTGGTTACGGACGAGAGAAC
CAGAGCAGTGGCGGCTACGGACAGGAGAGCCAGAGCGGTGGTGGCTATGGACGAGAGAGCCAGAGCAGTGGTTAT
GGACAAGAGAGCTACGGGCGCCACAACCAAGCTGGTGGCTACGGACGAGAAAGCCAGAGCAGTGGTGGCTACGGA
CGGGAGAGCTTCGGACGAGAGAGCGAGAGCAGCGGCTACGGTCAGGATAGCGGCTACGGTCGCGGGAACCAGAGC
GGCACTTATGGCCGCGAAAGCGAGAGCAGTGGCTACGGTCGTGACAGCGGCTACGGCCGGCAAAACGAGGACAGC
GACAGCGGCAACGGAGGGTACGGGAAACCGAGAGGAGGCTACGGCCGACGGGACGACGACAGCGACGACAACGGC
GGTGGACGACACGGGCGCGGACATGGCGGCGGACATGGACGGCGGGCCGATGACAGCTCGGGCGACGACGGCGGA
CGAGGCGGCTACGGCCAGGGGGGAGGCGGTTATAGTCAGGGAGGGGGCGGCTACGGAGGCGGCGGAGGCCAGGGA
CGGCGCGGCTACGGCGGCCGGAGAGACAAAGATGACGACGACGACGACGACTCGTCGTCCAACTCGGGCAACGGC
CGGCGCGGACAGGGCCGACATGGATACTAG
Gene >Ophio5|4334
ATGCCTGACCTTAGAAACAGCGGCCCAATCCTGGGCCTCGTCATCCTCGTCGCCTTGATTGGTCCTGCCGCGGCC
TTTGGTGCTGGGAATATCGCCTCCATCTCCAAGCTCGAAGGCCAGAACTGTGCGACTCTCCATCCGTTCATACCC
ATGTCCACGATTGTGTGAGCTGACGTGCGTTGACAGGGCGACATGGCGACATCGAGGACGCACTTCTCACACTGG
CCATGGCACAGGCCATGAAGGGCAAGAAGTTTACCAAGATCATGGTCGCTCGCGTCTATTTCGGCAACTGGCTGC
GCGACTACTCCCAGGCTATCGACGTCGGCACCGTCAAGTCCGTCTCCGCCGAGGCCATCCGCCTTCTTCTCTGCG
TCCTCGGCTTCCTCACCTTTGGCTACGGCTCGGGCGAGTTCGAAGTGACGGCCGACCGTGTCGGATGCTACCGCC
CGGAGGATCACATCGACAACCCAAAGAACTATGCCGACAACCAGGACGCACGACAGTACGACCGCCGCCTCCGCG
GCCCTATCGACGAGGAGAGGGAGCTCTCCATCGATCCCCACACCGGCATGAAGAACTACATTGCCAACGAGCGTT
CCGGCATCATGACCTCTGCCCAGCACGTTAGGAGGCTCTTTGGCGGCTGCATCGAGCTCGGCCGCCGATACAAGG
AGAATGGCGATAAGAACGACCTTTACGAGTCGCTCCGCCTCATGGGCACTGGCCTTCACTGCCTCGAAGGTTCGT
TCAGCGCCGGTGCTGCGTCGTCCGTTGCGCTGACTGCTGTGCTACAGACTTTTTCGCTCACAGCAACTACACTGA
GCTCGCATTGATCGAGATGGGCGAGACTGAAGTCTTTCCTCACTGTGGACAAGACACCCTCTTGCAACTCGAGGG
CGCCCGCCAACCTGTCTACCCCATTGTTACCGGCACCTTTGGCGGCGTGGATTTCCTCCACTCTGTCGTGGGCGA
AGGTCAGGCATCCCACCAGGTCTCGGGGTATTGGAGCTGACCACAGCCGTAGTCTCGGACAAGTTGTCCCAGAAC
GAAATCGACGAGCTCGAAGGGGCGCTGCAGGAGAGCAAGAACTCCGACACCAGCATGCTCCGCGATCTTCTTGAC
AAGATACCCGATGGTCTACTCGGCGGCAAGAAGCAGACGGACAAGATCGACGAGATTCAGTCCAATGCGTCGGCG
GCCCAACTCCAGGGCATGTCCGTTTCACCGCGGCAACCGGAAGAGTTTACGGCGTATGTCACCCAAGTCTATGGC
CAGGTGATGCCGGCCATCAAGTTCCACGACGACATCATGAAGGCCATCACGGGCGCCATCGAGAATATTCCTGTG
CTGCCCAAGGTCATCGAGCAGCTGGAGGAGCAGCTGTCCAAGTTTGTCTTCTCCATCATGGCCCCTTTCGTGGTT
CCCCTGATCCAGCAGATCCGAAACGAGCTGCGGACCGGATCCGACGAGATTGTCCACAGCAGCCAGCAGGAGCAG
CACGTTGTCTTTGAGGACGACCGGTGCAGCGACCCGACTCACTCGATGCTCTCCAAGGACCACTTCTCCAACGTA
GGACTACCTTCGCTCGGTCGCGGTTCTACTTGCTGACCGAGACATCAGATCTTGAACGAGATCGCCGGCCGAACA
GCGGCCAAGATGCTGCACTGGGTGGTCCCTCAACTCATGGACGCCATCGACGACGACAGCGTCGACGTGAACCGT
CTGCTGAACCGCATCATCTACGGCGTCATGCACCACCCAGCTCAGCGGGAGATGGGACAGGACGGCGTTGCCGAG
GCTCGACAGCTCATGTACGGCTGTGTGCAGGAGTGGTGGGGTGAGATCAGCGACGAGCAAAGGAACGACTACCGG
CGAAAGCTGTCCCGCGATGGCGTCCAGAACGGAGAAAATCACAAGGAGGGTGTCAACGATACGGGCCACGGCCAC
GGATGCGTGGGTAAGCTGAAGATGCGCAAGCTCTACGGCGAGCAAGACACGCTCGAGAACAGGATCGCGGGCGCG
GCTGCCAACGCCATCTTCCAGGGCGCTACGGGGGCCCTCTCGGGAGTGGTAGAGCAGAACACGGGCATCAAGCTG
CCGTCGGCGCAGGGCTCGCAGCAGCAGCAGGCCGAGGAGCGCAAGGAGGAGGGCGGCTTCGGCGGCTTCCTGGGC
TCCCTCCTGGGCGGCGCCTTTGGGAAGAGCAACAGCGAGTCGCACAGCAGCCAGCGGCGGGAGGACGACGGCTCG
GTGACGCAGACGCAGACGGAGTACGGTCGGCAGGGCCAGCACTACGGCCAGGCCGAGTACAGCCAGACGCAGCGT
CCGGACGGCAGCAGCGAGTCCCAGTACAGCCGGTTCGAACAGCAGGAGTCGCAGGGCGGGCGGCAGACGGCGGGC
TACGGCTACGAGGAGAGGACGGAGACGCGGCCGGCGCACGGCGGCGGGTACGAGCAGCGGACCGAGAGGCAGGAG
TACAGGGGCTACGGCCAGGGCGGCGGCTACGGACGAGAGAGCCAGAGCAGTGGTGGCTACGGACAAGAGAGCTAC
GGCCGCCACAACCAAGCCGGTGGTTACGGACGAGAGAACCAGAGCAGTGGCGGCTACGGACAAGAGAGCCAGAGC
GGTGGTGGCTATGGACAAGAGAGCTACGGCCGCCACAACCAAGCCGGTGGTTACGGACGAGAGAACCAGAGCAGT
GGCGGCTACGGACAGGAGAGCCAGAGCGGTGGTGGCTATGGACGAGAGAGCCAGAGCAGTGGTTATGGACAAGAG
AGCTACGGGCGCCACAACCAAGCTGGTGGCTACGGACGAGAAAGCCAGAGCAGTGGTGGCTACGGACGGGAGAGC
TTCGGACGAGAGAGCGAGAGCAGCGGCTACGGTCAGGATAGCGGCTACGGTCGCGGGAACCAGAGCGGCACTTAT
GGCCGCGAAAGCGAGAGCAGTGGCTACGGTCGTGACAGCGGCTACGGCCGGCAAAACGAGGACAGCGACAGCGGC
AACGGAGGGTACGGGAAACCGAGAGGAGGCTACGGCCGACGGGACGACGACAGCGACGACAACGGCGGTGGACGA
CACGGGCGCGGACATGGCGGCGGACATGGACGGCGGGCCGATGACAGCTCGGGCGACGACGGCGGACGAGGCGGC
TACGGCCAGGGGGGAGGCGGTTATAGTCAGGGAGGGGGCGGCTACGGAGGCGGCGGAGGCCAGGGACGGCGCGGC
TACGGCGGCCGGAGAGACAAAGATGACGACGACGACGACGACTCGTCGTCCAACTCGGGCAACGGCCGGCGCGGA
CAGGGCCGACATGGATACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail