Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4333
Gene name
Locationscaffold_342:9011..11106
Strand-
Gene length (bp)2095
Transcript length (bp)1785
Coding sequence length (bp)1782
Protein length (aa) 594

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 1.2E-08 373 417

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTR5|YG66_SCHPO Uncharacterized RING finger membrane protein C15C4.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.06c PE=3 SV=1 6 417 8.0E-12
sp|Q8LDB8|RING2_ARATH E3 ubiquitin-protein ligase At1g63170 OS=Arabidopsis thaliana GN=At1g63170 PE=2 SV=2 374 421 9.0E-07
sp|Q9LN71|RING1_ARATH E3 ubiquitin-protein ligase At1g12760 OS=Arabidopsis thaliana GN=At1g12760 PE=1 SV=1 373 421 9.0E-07
sp|Q8GT74|NIP2_ARATH NEP1-interacting protein 2 OS=Arabidopsis thaliana GN=NIP2 PE=1 SV=1 356 417 9.0E-07
sp|Q6GPV5|RN181_XENLA E3 ubiquitin-protein ligase RNF181 OS=Xenopus laevis GN=rnf181 PE=2 SV=1 373 446 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q1MTR5|YG66_SCHPO Uncharacterized RING finger membrane protein C15C4.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.06c PE=3 SV=1 6 417 8.0E-12
sp|Q8LDB8|RING2_ARATH E3 ubiquitin-protein ligase At1g63170 OS=Arabidopsis thaliana GN=At1g63170 PE=2 SV=2 374 421 9.0E-07
sp|Q9LN71|RING1_ARATH E3 ubiquitin-protein ligase At1g12760 OS=Arabidopsis thaliana GN=At1g12760 PE=1 SV=1 373 421 9.0E-07
sp|Q8GT74|NIP2_ARATH NEP1-interacting protein 2 OS=Arabidopsis thaliana GN=NIP2 PE=1 SV=1 356 417 9.0E-07
sp|Q6GPV5|RN181_XENLA E3 ubiquitin-protein ligase RNF181 OS=Xenopus laevis GN=rnf181 PE=2 SV=1 373 446 2.0E-06
sp|Q9SUS4|RHA1A_ARATH RING-H2 zinc finger protein RHA1a OS=Arabidopsis thaliana GN=RHA1A PE=2 SV=1 374 423 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 226 248 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4333
MSLIEIQNAVLLVSNPVWEGDKTVPSTLVRNISALSSQIGYEDRISTNLTTLTTTNAPKLDGTFGGLLFVPQLTA
VPDCDAQQYDFLPRNVTRREQLPPSNLNVVAIAPWFSIECTRAYLASAARGSARALIFYKPNNSTNKPQEVDSPV
WSLDDDDAWRKNHHFPIFAIPGLEGQKIVMKLSLYSGSIDQVPHGQEIGQLYGPNPSDYVRVWTDLTMQNTSNVP
AVWAFVLIVIAALLFVIAVVSLIMHFIQRRNRTSLQRRVQSGEVDLEAMGIKRLTVPPSHVDRFPLFTYNAEAEL
ANALAVPRSPVEATPTHPRRPSRKGRRAEPRSASADAAHSAGPRSVRSVRSIRSKRSSITGNTDTTATNFQPNCH
ICLAGFEHCKTVIRELPCGHIFHPACIDEFLTQNSSLCPMCKHCMLPRGYSPKITNGMVRREQAVRRLREHVDLE
DSSVDSGEPKLKEWGKRFFTTNHAHAPSPTVKSPGPAESGTAISAGDAPSTSVTPAPDAPQPPPAAAQKVEFRRT
RPRALRLLPTHHEGVEPKEEEAVGRLSPSSFARERMRQIAASNAPFDDDLDRQRPKWRRALSKAFPGFS
Coding >Ophio5|4333
ATGTCGCTCATCGAGATTCAAAATGCCGTACTCCTGGTCAGCAACCCGGTTTGGGAGGGTGACAAGACGGTCCCC
TCGACGCTCGTCAGGAACATATCTGCCCTGTCTAGCCAGATAGGCTACGAGGATCGCATATCAACCAACCTCACC
ACCCTCACCACCACAAACGCCCCGAAGCTCGACGGCACCTTTGGCGGCCTCCTCTTCGTTCCTCAGCTCACCGCC
GTCCCCGACTGCGACGCACAGCAGTACGACTTCCTTCCCCGCAATGTCACCCGCCGCGAGCAGCTCCCGCCGAGC
AACCTCAATGTCGTCGCCATCGCCCCCTGGTTCAGCATCGAGTGCACCCGTGCCTACCTCGCCTCTGCCGCTCGC
GGCTCCGCGCGTGCCCTCATCTTCTACAAGCCCAACAACTCGACCAACAAGCCGCAAGAGGTCGACTCGCCCGTC
TGGAGCCTCGACGACGACGACGCCTGGAGGAAGAACCACCACTTCCCCATCTTCGCCATACCGGGCCTCGAGGGC
CAGAAGATTGTCATGAAGCTGAGCCTCTACTCCGGCTCCATCGACCAGGTGCCCCACGGCCAAGAGATCGGCCAG
CTCTACGGCCCGAACCCCAGCGACTACGTCCGCGTCTGGACCGACCTGACGATGCAAAATACGTCCAACGTCCCC
GCCGTCTGGGCCTTTGTTCTCATCGTCATCGCCGCCCTGCTCTTCGTCATCGCCGTCGTCTCCCTCATCATGCAC
TTTATCCAGCGCCGGAACCGCACTTCGCTGCAACGCCGCGTCCAGTCGGGTGAGGTGGACCTCGAGGCCATGGGC
ATCAAGCGCCTGACCGTCCCGCCCTCCCACGTCGACCGCTTCCCGCTCTTCACCTATAATGCCGAGGCCGAGCTG
GCCAACGCCCTGGCCGTCCCGCGGTCGCCCGTCGAAGCCACCCCGACGCACCCCCGCAGGCCGTCACGCAAGGGC
CGTCGCGCCGAGCCGCGGTCCGCCTCGGCTGACGCTGCCCACTCGGCCGGCCCCCGGAGCGTGCGCAGTGTTCGC
AGCATCCGCAGCAAGAGGTCGAGCATCACGGGTAACACGGACACGACGGCCACCAACTTCCAGCCCAACTGCCAC
ATCTGCCTCGCCGGCTTCGAGCACTGCAAGACGGTCATCCGCGAGCTGCCCTGCGGCCACATCTTTCACCCGGCC
TGCATCGACGAGTTTCTCACGCAGAACAGCTCGCTGTGCCCCATGTGCAAGCACTGCATGCTGCCTCGCGGCTAC
AGCCCCAAGATTACCAACGGCATGGTCCGTCGCGAGCAGGCCGTGCGCCGGCTGCGGGAACACGTCGACCTCGAA
GACTCGTCCGTCGACTCGGGCGAGCCGAAGCTCAAGGAATGGGGCAAGCGCTTCTTCACCACGAACCACGCCCAC
GCGCCGAGTCCGACGGTCAAGTCCCCTGGTCCCGCCGAGTCGGGCACGGCGATTTCGGCCGGGGATGCCCCCTCC
ACCTCGGTCACGCCCGCGCCGGACGCTCCCCAGCCGCCGCCCGCCGCGGCGCAGAAAGTCGAATTCCGGAGGACG
CGACCCCGGGCGCTGAGACTGCTGCCCACGCATCACGAGGGGGTCGAGCCCAAGGAGGAGGAGGCCGTCGGCCGC
TTGAGCCCATCGTCGTTTGCCCGGGAGCGGATGCGGCAGATTGCCGCCAGCAACGCGCCCTTTGACGATGACCTG
GACCGTCAGCGTCCCAAGTGGCGACGAGCGCTGTCCAAAGCCTTTCCCGGCTTTTCC
Transcript >Ophio5|4333
ATGTCGCTCATCGAGATTCAAAATGCCGTACTCCTGGTCAGCAACCCGGTTTGGGAGGGTGACAAGACGGTCCCC
TCGACGCTCGTCAGGAACATATCTGCCCTGTCTAGCCAGATAGGCTACGAGGATCGCATATCAACCAACCTCACC
ACCCTCACCACCACAAACGCCCCGAAGCTCGACGGCACCTTTGGCGGCCTCCTCTTCGTTCCTCAGCTCACCGCC
GTCCCCGACTGCGACGCACAGCAGTACGACTTCCTTCCCCGCAATGTCACCCGCCGCGAGCAGCTCCCGCCGAGC
AACCTCAATGTCGTCGCCATCGCCCCCTGGTTCAGCATCGAGTGCACCCGTGCCTACCTCGCCTCTGCCGCTCGC
GGCTCCGCGCGTGCCCTCATCTTCTACAAGCCCAACAACTCGACCAACAAGCCGCAAGAGGTCGACTCGCCCGTC
TGGAGCCTCGACGACGACGACGCCTGGAGGAAGAACCACCACTTCCCCATCTTCGCCATACCGGGCCTCGAGGGC
CAGAAGATTGTCATGAAGCTGAGCCTCTACTCCGGCTCCATCGACCAGGTGCCCCACGGCCAAGAGATCGGCCAG
CTCTACGGCCCGAACCCCAGCGACTACGTCCGCGTCTGGACCGACCTGACGATGCAAAATACGTCCAACGTCCCC
GCCGTCTGGGCCTTTGTTCTCATCGTCATCGCCGCCCTGCTCTTCGTCATCGCCGTCGTCTCCCTCATCATGCAC
TTTATCCAGCGCCGGAACCGCACTTCGCTGCAACGCCGCGTCCAGTCGGGTGAGGTGGACCTCGAGGCCATGGGC
ATCAAGCGCCTGACCGTCCCGCCCTCCCACGTCGACCGCTTCCCGCTCTTCACCTATAATGCCGAGGCCGAGCTG
GCCAACGCCCTGGCCGTCCCGCGGTCGCCCGTCGAAGCCACCCCGACGCACCCCCGCAGGCCGTCACGCAAGGGC
CGTCGCGCCGAGCCGCGGTCCGCCTCGGCTGACGCTGCCCACTCGGCCGGCCCCCGGAGCGTGCGCAGTGTTCGC
AGCATCCGCAGCAAGAGGTCGAGCATCACGGGTAACACGGACACGACGGCCACCAACTTCCAGCCCAACTGCCAC
ATCTGCCTCGCCGGCTTCGAGCACTGCAAGACGGTCATCCGCGAGCTGCCCTGCGGCCACATCTTTCACCCGGCC
TGCATCGACGAGTTTCTCACGCAGAACAGCTCGCTGTGCCCCATGTGCAAGCACTGCATGCTGCCTCGCGGCTAC
AGCCCCAAGATTACCAACGGCATGGTCCGTCGCGAGCAGGCCGTGCGCCGGCTGCGGGAACACGTCGACCTCGAA
GACTCGTCCGTCGACTCGGGCGAGCCGAAGCTCAAGGAATGGGGCAAGCGCTTCTTCACCACGAACCACGCCCAC
GCGCCGAGTCCGACGGTCAAGTCCCCTGGTCCCGCCGAGTCGGGCACGGCGATTTCGGCCGGGGATGCCCCCTCC
ACCTCGGTCACGCCCGCGCCGGACGCTCCCCAGCCGCCGCCCGCCGCGGCGCAGAAAGTCGAATTCCGGAGGACG
CGACCCCGGGCGCTGAGACTGCTGCCCACGCATCACGAGGGGGTCGAGCCCAAGGAGGAGGAGGCCGTCGGCCGC
TTGAGCCCATCGTCGTTTGCCCGGGAGCGGATGCGGCAGATTGCCGCCAGCAACGCGCCCTTTGACGATGACCTG
GACCGTCAGCGTCCCAAGTGGCGACGAGCGCTGTCCAAAGCCTTTCCCGGCTTTTCCTAG
Gene >Ophio5|4333
ATGTGTGAGTTGCCTCTTCTCTTCTTGGCTTTTCCCACCGCCAAGATGCTTGCCGCCCAGCCGCAGTCAGCACTA
ATCGCCTTGCCAGCGCTCATCGAGATTCAAAATGCCGTGTGCGTCGTTGCTCGCCCTTTGCTCGCCCCTTCGCTC
TCCCGAATGCCTCGCGAGCTCGTCCCGCTGACTGCTTCCTCCCACCCCCAGACTCCTGGTCAGCAACCCGGTTTG
GGAGGGTGACAAGACGGTCCCCTCGACGCTCGTCAGGAACATATCTGCCCTGTCTGTATGTCTCACCTCTACTCT
TCGAGCCTCCCACCTCGAAGCCAGCGGCTGACGCCTCCCCCCCCACCGCCAAGAGCCAGATAGGCTACGAGGATC
GCATATCAACCAACCTCACCACCCTCACCACCACAAACGCCCCGAAGCTCGACGGCACCTTTGGCGGCCTCCTCT
TCGTTCCTCAGCTCACCGCCGTCCCCGACTGCGACGCACAGCAGTACGACTTCCTTCCCCGCAATGTCACCCGCC
GCGAGCAGCTCCCGCCGAGCAACCTCAATGTCGTCGCCATCGCCCCCTGGTTCAGCATCGAGTGCACCCGTGCCT
ACCTCGCCTCTGCCGCTCGCGGCTCCGCGCGTGCCCTCATCTTCTACAAGCCCAACAACTCGACCAACAAGCCGC
AAGAGGTCGACTCGCCCGTCTGGAGCCTCGACGACGACGACGCCTGGAGGAAGAACCACCACTTCCCCATCTTCG
CCATACCGGGCCTCGAGGGCCAGAAGATTGTCATGAAGCTGAGCCTCTACTCCGGCTCCATCGACCAGGTGCCCC
ACGGCCAAGAGATCGGCCAGCTCTACGGCCCGAACCCCAGCGACTACGTCCGCGTCTGGACCGACCTGACGATGC
AAAATACGTCCAACGTCCCCGCCGTCTGGGCCTTTGTTCTCATCGTCATCGCCGCCCTGCTCTTCGTCATCGCCG
TCGTCTCCCTCATCATGCACTTTATCCAGCGCCGGAACCGCACTTCGCTGCAACGCCGCGTCCAGTCGGGTGAGG
TGGACCTCGAGGCCATGGGCATCAAGCGCCTGACCGTCCCGCCCTCCCACGTCGACCGCTTCCCGCTCTTCACCT
ATAATGCCGAGGCCGAGCTGGCCAACGCCCTGGCCGTCCCGCGGTCGCCCGTCGAAGCCACCCCGACGCACCCCC
GCAGGCCGTCACGCAAGGGCCGTCGCGCCGAGCCGCGGTCCGCCTCGGCTGACGCTGCCCACTCGGCCGGCCCCC
GGAGCGTGCGCAGTGTTCGCAGCATCCGCAGCAAGAGGTCGAGCATCACGGGTAACACGGACACGACGGCCACCA
ACTTCCAGCCCAACTGCCACATCTGCCTCGCCGGCTTCGAGCACTGCAAGACGGTCATCCGCGAGCTGCCCTGCG
GCCACATCTTTCACCCGGCCTGCATCGACGAGTTTCTCACGCAGAACAGCTCGCTGTGCCCCATGTGCAAGCACT
GCATGCTGCCTCGCGGCTACAGCCCCAAGATTACCAACGGCATGGTCCGTCGCGAGCAGGCCGTGCGCCGGCTGC
GGGAACACGTCGACCTCGAAGACTCGTCCGTCGACTCGGGCGAGCCGAAGCTCAAGGAATGGGGCAAGCGCTTCT
TCACCACGAACCACGCCCACGCGCCGAGTCCGACGGTCAAGTCCCCTGGTCCCGCCGAGTCGGGCACGGCGATTT
CGGCCGGGGATGCCCCCTCCACCTCGGTCACGCCCGCGCCGGACGCTCCCCAGCCGCCGCCCGCCGCGGCGCAGA
AAGTCGAATTCCGGAGGACGCGACCCCGGGCGCTGAGACTGCTGCCCACGCATCACGAGGGGGTCGAGCCCAAGG
AGGAGGAGGCCGTCGGCCGCTTGAGCCCATCGTCGTTTGCCCGGGAGCGGATGCGGCAGATTGCCGCCAGCAACG
CGCCCTTTGACGATGACCTGGACCGTCAGCGTCCCAAGTGTGAGTCCTTCCCGGTGCGATTTGCGTGTCGAGTCT
GCCCACTGACATACGCATCATGTATACAGGGCGACGAGCGCTGTCCAAAGCCTTTCCCGGCTTTTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail