Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4329
Gene name
Locationscaffold_342:645..2507
Strand-
Gene length (bp)1862
Transcript length (bp)1764
Coding sequence length (bp)1761
Protein length (aa) 587

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74949|YJBC_SCHPO Uncharacterized protein C553.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC553.12c PE=4 SV=2 33 585 6.0E-87

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 13 0.45

Transmembrane Domains

Domain # Start End Length
1 108 130 22
2 160 182 22
3 195 217 22
4 232 251 19
5 318 340 22
6 360 382 22
7 395 412 17
8 422 441 19
9 474 496 22
10 516 535 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4329
MSFFQFTQGTEAHTRPNDSSPLLGRYRAVLPRHGHRGAGRLSANDRLGGRGSVHVGYGALMAAELAEDDDEEQQQ
HADPSLRAWLLHLWVVPRQSAVKRVVDRWWSRYGLLVVLPAVLVVGWCAVPFPQYPLHGDDPEPAPPDGESKTPG
HGAARVRVNFWFFLFVYYGFYSLTALVWITKVFNLYSLNWWPRSLGFPLTLSLIGALSLAVPIPIYFGRETRFLT
EHNTAWIAWTFVVMALPVAMALAILMTNERHVGARHSLSETQRIFTSSWWSSEPDDRRRDGAAVAALTAAVSAPA
PAPASASAAARRAGWQPASFVRFLWLCVALSIGLLAYVLGEAYAELYLRTLPHNSLETVVYVYGWVATVHLLDAL
TGWTLGIREGERVGSYPLSWVFKLYFTLTYQTYVRALYARLRSPSQFMVLQLLSSTSLVVLTPLSMTRRCHRALV
RTGLNGQSYGSYQKLQARNVFIRFLAENASMATFLGSIVVLHFGANRDVYPYFALDDVDEPYDLALTLWASSVTW
ACEVVASLAVRSLIRLCFEVDVGLEARQDLAVWPELLPTCVTVTLHVLQNMMFSIIRLQFYE
Coding >Ophio5|4329
ATGTCCTTCTTCCAGTTCACGCAGGGCACTGAGGCTCACACGCGACCCAACGACTCTTCGCCGCTACTGGGCCGG
TATCGCGCCGTGCTGCCGCGTCACGGCCACCGGGGCGCGGGCCGGCTGTCGGCGAACGATAGGCTGGGCGGGCGC
GGGAGCGTGCATGTCGGATACGGAGCGCTGATGGCGGCGGAGCTTGCCGAAGACGATGACGAGGAGCAGCAGCAG
CATGCAGACCCATCGTTGCGTGCCTGGTTGCTCCATCTGTGGGTTGTGCCCAGGCAGTCGGCCGTGAAGCGGGTG
GTGGACCGATGGTGGAGTCGGTATGGACTGCTGGTGGTGCTGCCGGCGGTACTGGTTGTCGGCTGGTGCGCCGTG
CCCTTCCCGCAGTATCCACTCCACGGCGACGATCCGGAGCCGGCCCCGCCGGACGGAGAGTCCAAGACGCCGGGT
CACGGGGCGGCGCGGGTGCGAGTCAATTTCTGGTTCTTCCTGTTCGTCTACTACGGCTTCTACAGCCTGACGGCA
CTGGTATGGATCACCAAGGTGTTTAACCTGTACAGCCTGAACTGGTGGCCGCGGTCGCTCGGCTTCCCGCTTACG
CTGTCGCTCATCGGCGCGCTTTCTCTGGCGGTGCCCATCCCCATCTATTTCGGACGCGAGACGCGCTTCCTCACG
GAGCATAACACGGCGTGGATCGCATGGACGTTTGTCGTCATGGCGCTGCCGGTAGCCATGGCTCTGGCCATACTC
ATGACCAACGAGCGGCACGTCGGTGCGCGACACTCGCTGTCCGAGACGCAGCGCATCTTCACCTCTTCCTGGTGG
AGCAGCGAGCCCGATGACCGGCGCCGGGACGGGGCGGCGGTGGCGGCCCTGACGGCGGCCGTCTCGGCACCGGCA
CCGGCACCGGCATCGGCATCGGCCGCGGCACGGCGAGCCGGTTGGCAGCCTGCCAGCTTCGTGCGCTTCCTATGG
CTGTGCGTGGCGCTGTCCATCGGCCTGCTGGCCTACGTCTTGGGCGAGGCCTACGCCGAGCTCTACCTCCGCACC
CTGCCGCACAACAGTCTGGAGACGGTCGTCTACGTCTACGGCTGGGTGGCGACGGTTCATCTGCTGGACGCGCTG
ACGGGCTGGACGCTGGGGATCCGCGAGGGTGAGCGCGTCGGAAGCTACCCTCTCAGCTGGGTCTTCAAGCTCTAC
TTCACCCTGACGTATCAGACATACGTGCGAGCTCTGTACGCGCGCCTCCGGTCCCCGTCACAATTCATGGTCCTC
CAACTCCTGTCGTCGACGAGCCTGGTGGTGCTGACGCCTCTATCGATGACGCGACGCTGTCACCGAGCGCTGGTC
AGGACCGGTCTCAACGGCCAGAGCTACGGCTCCTACCAAAAGCTTCAAGCGCGCAACGTCTTCATCCGTTTCCTA
GCGGAGAATGCGTCCATGGCCACCTTTCTCGGCAGCATCGTCGTCCTCCACTTCGGCGCCAACCGCGACGTGTAC
CCTTACTTTGCTCTCGACGACGTCGACGAGCCGTACGATCTCGCCCTCACCCTCTGGGCTTCCTCCGTCACCTGG
GCGTGCGAAGTCGTCGCCAGCCTGGCCGTGCGGTCGCTCATCCGCTTGTGCTTCGAGGTCGATGTCGGGCTCGAG
GCGAGGCAGGATTTGGCTGTTTGGCCGGAGCTTTTACCGACTTGTGTGACGGTTACGTTGCATGTGTTGCAGAAT
ATGATGTTTTCCATTATACGGCTGCAGTTTTACGAG
Transcript >Ophio5|4329
ATGTCCTTCTTCCAGTTCACGCAGGGCACTGAGGCTCACACGCGACCCAACGACTCTTCGCCGCTACTGGGCCGG
TATCGCGCCGTGCTGCCGCGTCACGGCCACCGGGGCGCGGGCCGGCTGTCGGCGAACGATAGGCTGGGCGGGCGC
GGGAGCGTGCATGTCGGATACGGAGCGCTGATGGCGGCGGAGCTTGCCGAAGACGATGACGAGGAGCAGCAGCAG
CATGCAGACCCATCGTTGCGTGCCTGGTTGCTCCATCTGTGGGTTGTGCCCAGGCAGTCGGCCGTGAAGCGGGTG
GTGGACCGATGGTGGAGTCGGTATGGACTGCTGGTGGTGCTGCCGGCGGTACTGGTTGTCGGCTGGTGCGCCGTG
CCCTTCCCGCAGTATCCACTCCACGGCGACGATCCGGAGCCGGCCCCGCCGGACGGAGAGTCCAAGACGCCGGGT
CACGGGGCGGCGCGGGTGCGAGTCAATTTCTGGTTCTTCCTGTTCGTCTACTACGGCTTCTACAGCCTGACGGCA
CTGGTATGGATCACCAAGGTGTTTAACCTGTACAGCCTGAACTGGTGGCCGCGGTCGCTCGGCTTCCCGCTTACG
CTGTCGCTCATCGGCGCGCTTTCTCTGGCGGTGCCCATCCCCATCTATTTCGGACGCGAGACGCGCTTCCTCACG
GAGCATAACACGGCGTGGATCGCATGGACGTTTGTCGTCATGGCGCTGCCGGTAGCCATGGCTCTGGCCATACTC
ATGACCAACGAGCGGCACGTCGGTGCGCGACACTCGCTGTCCGAGACGCAGCGCATCTTCACCTCTTCCTGGTGG
AGCAGCGAGCCCGATGACCGGCGCCGGGACGGGGCGGCGGTGGCGGCCCTGACGGCGGCCGTCTCGGCACCGGCA
CCGGCACCGGCATCGGCATCGGCCGCGGCACGGCGAGCCGGTTGGCAGCCTGCCAGCTTCGTGCGCTTCCTATGG
CTGTGCGTGGCGCTGTCCATCGGCCTGCTGGCCTACGTCTTGGGCGAGGCCTACGCCGAGCTCTACCTCCGCACC
CTGCCGCACAACAGTCTGGAGACGGTCGTCTACGTCTACGGCTGGGTGGCGACGGTTCATCTGCTGGACGCGCTG
ACGGGCTGGACGCTGGGGATCCGCGAGGGTGAGCGCGTCGGAAGCTACCCTCTCAGCTGGGTCTTCAAGCTCTAC
TTCACCCTGACGTATCAGACATACGTGCGAGCTCTGTACGCGCGCCTCCGGTCCCCGTCACAATTCATGGTCCTC
CAACTCCTGTCGTCGACGAGCCTGGTGGTGCTGACGCCTCTATCGATGACGCGACGCTGTCACCGAGCGCTGGTC
AGGACCGGTCTCAACGGCCAGAGCTACGGCTCCTACCAAAAGCTTCAAGCGCGCAACGTCTTCATCCGTTTCCTA
GCGGAGAATGCGTCCATGGCCACCTTTCTCGGCAGCATCGTCGTCCTCCACTTCGGCGCCAACCGCGACGTGTAC
CCTTACTTTGCTCTCGACGACGTCGACGAGCCGTACGATCTCGCCCTCACCCTCTGGGCTTCCTCCGTCACCTGG
GCGTGCGAAGTCGTCGCCAGCCTGGCCGTGCGGTCGCTCATCCGCTTGTGCTTCGAGGTCGATGTCGGGCTCGAG
GCGAGGCAGGATTTGGCTGTTTGGCCGGAGCTTTTACCGACTTGTGTGACGGTTACGTTGCATGTGTTGCAGAAT
ATGATGTTTTCCATTATACGGCTGCAGTTTTACGAGTGA
Gene >Ophio5|4329
ATGTCCTTCTTCCAGTTCACGCAGGGCACTGAGGCTCACACGCGACCCAACGACTCTTCGCCGCTACTGGGCCGG
TATCGCGCCGTGCTGCCGCGTCACGGCCACCGGGGCGCGGGCCGGCTGTCGGCGAACGATAGGCTGGGCGGGCGC
GGGAGCGTGCATGTCGGATACGGAGCGCTGATGGCGGCGGAGCTTGCCGAAGACGATGACGAGGAGCAGCAGCAG
CATGCAGACCCATCGTTGCGTGCCTGGTTGCTCCATCTGTGGGTTGTGCCCAGGCAGTCGGCCGTGAAGCGGGTG
GTGGACCGATGGTGGAGTCGGTATGGACTGCTGGTGGTGCTGCCGGCGGTACTGGTAGGTTCGGTCGGGGAGAGA
GGACCCCATGACCGAGTTGGGCTGACGGTTTCCCTTTTTTTTTTTTTTCCTTTTTTTTTTCTGTGTGTTCTGAGC
AGGTTGTCGGCTGGTGCGCCGTGCCCTTCCCGCAGTATCCACTCCACGGCGACGATCCGGAGCCGGCCCCGCCGG
ACGGAGAGTCCAAGACGCCGGGTCACGGGGCGGCGCGGGTGCGAGTCAATTTCTGGTTCTTCCTGTTCGTCTACT
ACGGCTTCTACAGCCTGACGGCACTGGTATGGATCACCAAGGTGTTTAACCTGTACAGCCTGAACTGGTGGCCGC
GGTCGCTCGGCTTCCCGCTTACGCTGTCGCTCATCGGCGCGCTTTCTCTGGCGGTGCCCATCCCCATCTATTTCG
GACGCGAGACGCGCTTCCTCACGGAGCATAACACGGCGTGGATCGCATGGACGTTTGTCGTCATGGCGCTGCCGG
TAGCCATGGCTCTGGCCATACTCATGACCAACGAGCGGCACGTCGGTGCGCGACACTCGCTGTCCGAGACGCAGC
GCATCTTCACCTCTTCCTGGTGGAGCAGCGAGCCCGATGACCGGCGCCGGGACGGGGCGGCGGTGGCGGCCCTGA
CGGCGGCCGTCTCGGCACCGGCACCGGCACCGGCATCGGCATCGGCCGCGGCACGGCGAGCCGGTTGGCAGCCTG
CCAGCTTCGTGCGCTTCCTATGGCTGTGCGTGGCGCTGTCCATCGGCCTGCTGGCCTACGTCTTGGGCGAGGCCT
ACGCCGAGCTCTACCTCCGCACCCTGCCGCACAACAGTCTGGAGACGGTCGTCTACGTCTACGGCTGGGTGGCGA
CGGTTCATCTGCTGGACGCGCTGACGGGCTGGACGCTGGGGATCCGCGAGGGTGAGCGCGTCGGAAGCTACCCTC
TCAGCTGGGTCTTCAAGCTCTACTTCACCCTGACGTATCAGACATACGTGCGAGCTCTGTACGCGCGCCTCCGGT
CCCCGTCACAATTCATGGTCCTCCAACTCCTGTCGTCGACGAGCCTGGTGGTGCTGACGCCTCTATCGATGACGC
GACGCTGTCACCGAGCGCTGGTCAGGACCGGTCTCAACGGCCAGAGCTACGGCTCCTACCAAAAGCTTCAAGCGC
GCAACGTCTTCATCCGTTTCCTAGCGGAGAATGCGTCCATGGCCACCTTTCTCGGCAGCATCGTCGTCCTCCACT
TCGGCGCCAACCGCGACGTGTACCCTTACTTTGCTCTCGACGACGTCGACGAGCCGTACGATCTCGCCCTCACCC
TCTGGGCTTCCTCCGTCACCTGGGCGTGCGAAGTCGTCGCCAGCCTGGCCGTGCGGTCGCTCATCCGCTTGTGCT
TCGAGGTCGATGTCGGGCTCGAGGCGAGGCAGGATTTGGCTGTTTGGCCGGAGCTTTTACCGACTTGTGTGACGG
TTACGTTGCATGTGTTGCAGAATATGATGTTTTCCATTATACGGCTGCAGTTTTACGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail