Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4324
Gene name
Locationscaffold_341:1560..6493
Strand-
Gene length (bp)4933
Transcript length (bp)4605
Coding sequence length (bp)4602
Protein length (aa) 1534

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00360 PHY Phytochrome region 1.7E-29 718 884
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 7.7E-19 1019 1145
PF00072 Response_reg Response regulator receiver domain 1.8E-15 1358 1482
PF00512 HisKA His Kinase A (phospho-acceptor) domain 4.3E-12 910 972
PF01590 GAF GAF domain 1.5E-10 539 698
PF08446 PAS_2 PAS fold 4.1E-09 338 411

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9R6X3|PHYB_NOSS1 Cyanobacterial phytochrome B OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=bphB PE=3 SV=1 544 1143 3.0E-55
sp|Q9LCC2|PHYA_NOSS1 Cyanobacterial phytochrome A OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=aphA PE=3 SV=1 532 1144 4.0E-52
sp|Q55168|PHY1_SYNY3 Phytochrome-like protein cph1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cph1 PE=1 SV=1 532 1144 1.0E-50
sp|Q9HWR3|BPHY_PSEAE Bacteriophytochrome OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bphP PE=1 SV=1 335 1127 7.0E-48
sp|Q9RZA4|BPHY_DEIRA Bacteriophytochrome OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=bphP PE=1 SV=1 533 1144 9.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9R6X3|PHYB_NOSS1 Cyanobacterial phytochrome B OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=bphB PE=3 SV=1 544 1143 3.0E-55
sp|Q9LCC2|PHYA_NOSS1 Cyanobacterial phytochrome A OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=aphA PE=3 SV=1 532 1144 4.0E-52
sp|Q55168|PHY1_SYNY3 Phytochrome-like protein cph1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cph1 PE=1 SV=1 532 1144 1.0E-50
sp|Q9HWR3|BPHY_PSEAE Bacteriophytochrome OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bphP PE=1 SV=1 335 1127 7.0E-48
sp|Q9RZA4|BPHY_DEIRA Bacteriophytochrome OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=bphP PE=1 SV=1 533 1144 9.0E-32
sp|P55004|PHYE_IPONI Phytochrome E OS=Ipomoea nil GN=PHYE PE=2 SV=1 551 887 3.0E-31
sp|Q10CQ8|PHYC_ORYSJ Phytochrome C OS=Oryza sativa subsp. japonica GN=PHYC PE=2 SV=1 518 933 1.0E-28
sp|A2XM23|PHYC_ORYSI Phytochrome C OS=Oryza sativa subsp. indica GN=PHYC PE=3 SV=2 518 933 3.0E-28
sp|P29130|PHYB_TOBAC Phytochrome B OS=Nicotiana tabacum GN=PHYB PE=2 SV=2 551 906 3.0E-28
sp|P14714|PHYC_ARATH Phytochrome C OS=Arabidopsis thaliana GN=PHYC PE=1 SV=1 518 887 4.0E-28
sp|P42499|PHYB_SOYBN Phytochrome B OS=Glycine max GN=PHYB PE=3 SV=1 518 887 5.0E-28
sp|P93673|PHYA_LATSA Phytochrome type A OS=Lathyrus sativus GN=PHYA PE=3 SV=1 518 887 1.0E-27
sp|P42498|PHYE_ARATH Phytochrome E OS=Arabidopsis thaliana GN=PHYE PE=1 SV=2 551 887 2.0E-27
sp|P33530|PHYA1_TOBAC Phytochrome A1 OS=Nicotiana tabacum GN=PHYA1 PE=3 SV=1 518 887 2.0E-27
sp|P33529|PHY_MOUSC Phytochrome OS=Mougeotia scalaris GN=PHY PE=2 SV=2 518 978 2.0E-27
sp|P34094|PHYB_SOLTU Phytochrome B OS=Solanum tuberosum GN=PHYB PE=3 SV=2 551 887 2.0E-27
sp|P93528|PHYC_SORBI Phytochrome C OS=Sorghum bicolor GN=PHYC PE=2 SV=1 518 883 7.0E-27
sp|P15001|PHYA_PEA Phytochrome A OS=Pisum sativum GN=PHYA PE=3 SV=1 518 887 7.0E-27
sp|P14712|PHYA_ARATH Phytochrome A OS=Arabidopsis thaliana GN=PHYA PE=1 SV=2 518 887 8.0E-27
sp|P55141|PHYA_PETCR Phytochrome A OS=Petroselinum crispum GN=PHYA PE=2 SV=1 518 907 2.0E-26
sp|Q10MG9|PHYB_ORYSJ Phytochrome B OS=Oryza sativa subsp. japonica GN=PHYB PE=2 SV=1 546 887 3.0E-26
sp|O49934|PHYA_POPTM Phytochrome A OS=Populus tremuloides GN=PHYA PE=2 SV=1 518 887 3.0E-26
sp|A2XFW2|PHYB_ORYSI Phytochrome B OS=Oryza sativa subsp. indica GN=PHYB PE=3 SV=2 551 887 3.0E-26
sp|P06592|PHYA_CUCPE Phytochrome A OS=Cucurbita pepo GN=PHYA PE=2 SV=1 518 887 4.0E-26
sp|P42496|PHY_ADICA Phytochrome 1 OS=Adiantum capillus-veneris GN=PHY1 PE=2 SV=2 552 933 5.0E-26
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 897 1180 7.0E-26
sp|P93527|PHYB_SORBI Phytochrome B OS=Sorghum bicolor GN=PHYB PE=3 SV=2 551 887 8.0E-26
sp|P42500|PHYA_SOYBN Phytochrome A OS=Glycine max GN=PHYA PE=2 SV=1 518 887 1.0E-25
sp|Q9ZS62|PHYB1_SOLLC Phytochrome B1 OS=Solanum lycopersicum GN=PHYB1 PE=2 SV=1 551 887 2.0E-25
sp|Q39557|PHY2_CERPU Phytochrome 2 OS=Ceratodon purpureus GN=PHY2 PE=3 SV=1 551 933 3.0E-25
sp|P42497|PHYD_ARATH Phytochrome D OS=Arabidopsis thaliana GN=PHYD PE=1 SV=2 551 887 3.0E-24
sp|P14713|PHYB_ARATH Phytochrome B OS=Arabidopsis thaliana GN=PHYB PE=1 SV=1 551 908 4.0E-24
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 898 1144 8.0E-24
sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase BarA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 892 1139 2.0E-23
sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=barA PE=1 SV=1 892 1139 2.0E-23
sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 892 1139 2.0E-23
sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase BarA OS=Shigella flexneri GN=barA PE=3 SV=1 892 1139 2.0E-23
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 898 1139 2.0E-23
sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=luxQ PE=1 SV=1 866 1149 2.0E-23
sp|Q41046|PHY_PINSY Phytochrome OS=Pinus sylvestris PE=2 SV=1 551 887 3.0E-23
sp|P58402|EVGS_ECO57 Sensor protein EvgS OS=Escherichia coli O157:H7 GN=evgS PE=3 SV=1 892 1144 3.0E-23
sp|Q40762|PHY_PICAB Phytochrome OS=Picea abies PE=2 SV=1 518 981 6.0E-23
sp|P36505|PHY1_PHYPA Phytochrome 1 OS=Physcomitrella patens subsp. patens GN=PHY1 PE=2 SV=2 551 933 7.0E-23
sp|P25848|PHY1_CERPU Light-sensor Protein kinase OS=Ceratodon purpureus GN=PHY1 PE=3 SV=3 518 935 8.0E-23
sp|P30733|PHYA_SOLTU Phytochrome A OS=Solanum tuberosum GN=PHYA PE=2 SV=2 518 887 9.0E-23
sp|P30855|EVGS_ECOLI Sensor protein EvgS OS=Escherichia coli (strain K12) GN=evgS PE=1 SV=2 897 1144 9.0E-23
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 892 1145 1.0E-22
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 885 1138 3.0E-22
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 896 1144 5.0E-22
sp|Q01549|PHY1_SELMA Phytochrome 1 OS=Selaginella martensii GN=PHY1 PE=3 SV=1 518 933 6.0E-22
sp|P93526|PHYA_SORBI Phytochrome a OS=Sorghum bicolor GN=PHYA PE=2 SV=1 518 887 6.0E-22
sp|Q10DU0|PHYA_ORYSJ Phytochrome A OS=Oryza sativa subsp. japonica GN=PHYA PE=2 SV=1 518 887 9.0E-22
sp|A2XLG5|PHYA_ORYSI Phytochrome A OS=Oryza sativa subsp. indica GN=PHYA PE=3 SV=2 518 887 9.0E-22
sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain YJ016) GN=luxQ PE=3 SV=1 901 1144 1.0E-21
sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 901 1144 2.0E-21
sp|P0DMC6|RCSC_ECOLX Sensor histidine kinase RcsC OS=Escherichia coli GN=rcsC PE=1 SV=1 899 1145 2.0E-21
sp|P0DMC5|RCSC_ECOLI Sensor histidine kinase RcsC OS=Escherichia coli (strain K12) GN=rcsC PE=1 SV=1 899 1145 2.0E-21
sp|P0AEC4|ARCB_SHIFL Aerobic respiration control sensor protein ArcB OS=Shigella flexneri GN=arcB PE=3 SV=1 896 1143 3.0E-21
sp|P0AEC3|ARCB_ECOLI Aerobic respiration control sensor protein ArcB OS=Escherichia coli (strain K12) GN=arcB PE=1 SV=1 896 1143 3.0E-21
sp|P58363|ARCB_ECO57 Aerobic respiration control sensor protein ArcB OS=Escherichia coli O157:H7 GN=arcB PE=3 SV=1 896 1143 3.0E-21
sp|P19862|PHYA1_MAIZE Phytochrome A OS=Zea mays GN=PHYA1 PE=3 SV=1 518 887 3.0E-21
sp|P37894|PLEC_CAUCR Non-motile and phage-resistance protein OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pleC PE=1 SV=2 827 1155 6.0E-21
sp|P06594|PHYA4_AVESA Phytochrome A type 4 OS=Avena sativa GN=PHYA4 PE=1 SV=3 518 904 1.0E-20
sp|P58662|RCSC_SALTY Sensor histidine kinase RcsC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rcsC PE=3 SV=1 899 1145 1.0E-20
sp|Q551X9|DHKF_DICDI Hybrid signal transduction histidine kinase F OS=Dictyostelium discoideum GN=dhkF PE=3 SV=1 893 1145 1.0E-20
sp|P26762|BVGS_BORBR Virulence sensor protein BvgS OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=bvgS PE=3 SV=2 854 1151 1.0E-20
sp|Q56128|RCSC_SALTI Sensor histidine kinase RcsC OS=Salmonella typhi GN=rcsC PE=3 SV=2 899 1145 2.0E-20
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 908 1145 2.0E-20
sp|P40330|BVGS_BORPA Virulence sensor protein BvgS OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=bvgS PE=3 SV=2 854 1151 3.0E-20
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 898 1139 3.0E-20
sp|P06593|PHYA3_AVESA Phytochrome A type 3 OS=Avena sativa GN=PHYA3 PE=1 SV=3 518 904 6.0E-20
sp|P16575|BVGS_BORPE Virulence sensor protein BvgS OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=bvgS PE=1 SV=3 854 1152 7.0E-20
sp|Q9XH58|ETR1_PELHO Ethylene receptor 1 OS=Pelargonium hortorum GN=ETR1 PE=2 SV=1 911 1143 1.0E-19
sp|Q3S4A7|AHK5_ARATH Histidine kinase 5 OS=Arabidopsis thaliana GN=AHK5 PE=1 SV=1 911 1167 1.0E-19
sp|Q9XH57|ETR2_PELHO Ethylene receptor 2 OS=Pelargonium hortorum GN=ETR2 PE=2 SV=1 911 1143 3.0E-19
sp|O82436|ETR1_CUCMN Ethylene receptor 1 OS=Cucumis melo var. cantalupensis GN=ETR1 PE=2 SV=1 911 1151 5.0E-19
sp|Q03228|DIVJ_CAUCR Histidine protein kinase DivJ OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=divJ PE=1 SV=2 892 1148 5.0E-19
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 912 1147 7.0E-19
sp|Q53RH0|ERS1_ORYSJ Probable ethylene response sensor 1 OS=Oryza sativa subsp. japonica GN=ERS1 PE=2 SV=1 911 1143 1.0E-18
sp|A2XL32|ERS1_ORYSI Probable ethylene response sensor 1 OS=Oryza sativa subsp. indica GN=ERS1 PE=2 SV=1 911 1143 1.0E-18
sp|Q9ZWL6|ETR1_PASED Ethylene receptor OS=Passiflora edulis GN=ETR1 PE=2 SV=1 911 1132 2.0E-18
sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 883 1145 3.0E-18
sp|Q5AHA0|CHK1_CANAL Histidine protein kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHK1 PE=2 SV=1 911 1143 6.0E-18
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 893 1139 1.0E-17
sp|Q9SSY6|ETR1_CUCSA Ethylene receptor 1 OS=Cucumis sativus GN=ETR1 PE=2 SV=1 911 1143 1.0E-17
sp|Q9M7M1|ETR1_PRUPE Ethylene receptor OS=Prunus persica GN=ETR1 PE=2 SV=1 911 1145 2.0E-17
sp|P06595|PHYA5_AVESA Phytochrome A type 5 (Fragment) OS=Avena sativa GN=PHYA5 PE=1 SV=3 518 708 4.0E-17
sp|Q8YIM6|PDHS_BRUME Cell-division control histidine kinase PdhS OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pdhS PE=3 SV=2 884 1149 5.0E-17
sp|Q57BR6|PDHS_BRUAB Cell-division control histidine kinase PdhS OS=Brucella abortus biovar 1 (strain 9-941) GN=pdhS PE=1 SV=1 884 1149 5.0E-17
sp|Q2YRB4|PDHS_BRUA2 Cell-division control histidine kinase PdhS OS=Brucella abortus (strain 2308) GN=pdhS PE=3 SV=1 884 1149 5.0E-17
sp|B2S758|PDHS_BRUA1 Cell-division control histidine kinase PdhS OS=Brucella abortus (strain S19) GN=pdhS PE=3 SV=1 884 1149 5.0E-17
sp|A5VRX4|PDHS_BRUO2 Cell-division control histidine kinase PdhS OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pdhS PE=3 SV=1 884 1149 6.0E-17
sp|B0CI82|PDHS_BRUSI Cell-division control histidine kinase PdhS OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pdhS PE=3 SV=1 884 1149 7.0E-17
sp|Q8FZ86|PDHS_BRUSU Cell-division control histidine kinase PdhS OS=Brucella suis biovar 1 (strain 1330) GN=pdhS PE=3 SV=1 884 1149 7.0E-17
sp|A9M715|PDHS_BRUC2 Cell-division control histidine kinase PdhS OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pdhS PE=3 SV=1 884 1149 8.0E-17
sp|Q87GU5|LUXQ_VIBPA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=luxQ PE=3 SV=1 911 1144 1.0E-16
sp|Q41342|ETR1_SOLLC Ethylene receptor 1 OS=Solanum lycopersicum GN=ETR1 PE=1 SV=1 911 1143 1.0E-16
sp|P54302|LUXQ_VIBHA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio harveyi GN=luxQ PE=1 SV=1 911 1252 1.0E-16
sp|P49333|ETR1_ARATH Ethylene receptor 1 OS=Arabidopsis thaliana GN=ETR1 PE=1 SV=1 911 1132 2.0E-16
sp|P44578|ARCB_HAEIN Aerobic respiration control sensor protein ArcB homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=arcB PE=3 SV=1 903 1123 2.0E-16
sp|O49230|ETR1_BRAOL Ethylene receptor 1 OS=Brassica oleracea GN=ETR1 PE=2 SV=1 911 1132 2.0E-16
sp|A6X5X4|PDHS_OCHA4 Cell-division control histidine kinase PdhS OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pdhS PE=3 SV=1 884 1149 2.0E-16
sp|O81122|ETR1_MALDO Ethylene receptor OS=Malus domestica GN=ETR1 PE=2 SV=1 911 1145 2.0E-16
sp|Q9HUI3|ARUS_PSEAE Sensor histidine kinase AruS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruS PE=3 SV=1 896 1151 2.0E-16
sp|Q9SXL4|AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana GN=AHK1 PE=1 SV=2 911 1137 9.0E-16
sp|P23545|PHOR_BACSU Alkaline phosphatase synthesis sensor protein PhoR OS=Bacillus subtilis (strain 168) GN=phoR PE=1 SV=1 911 1144 1.0E-15
sp|P58356|TORS_ECO57 Sensor protein TorS OS=Escherichia coli O157:H7 GN=torS PE=3 SV=1 911 1148 1.0E-15
sp|Q0DKM0|ERS2_ORYSJ Probable ethylene response sensor 2 OS=Oryza sativa subsp. japonica GN=ERS2 PE=2 SV=1 911 1132 2.0E-15
sp|B8AY75|ERS2_ORYSI Probable ethylene response sensor 2 OS=Oryza sativa subsp. indica GN=ERS2 PE=2 SV=1 911 1132 2.0E-15
sp|P39453|TORS_ECOLI Sensor protein TorS OS=Escherichia coli (strain K12) GN=torS PE=1 SV=4 911 1148 3.0E-15
sp|Q9P896|TCSA_EMENI Two-component system protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsA PE=3 SV=2 903 1139 3.0E-15
sp|Q38846|ERS1_ARATH Ethylene response sensor 1 OS=Arabidopsis thaliana GN=ERS1 PE=1 SV=1 911 1132 5.0E-15
sp|A1A696|OHK3_ORYSJ Probable histidine kinase 3 OS=Oryza sativa subsp. japonica GN=HK3 PE=2 SV=1 911 1160 7.0E-15
sp|A2WYI4|OHK3_ORYSI Probable histidine kinase 3 OS=Oryza sativa subsp. indica GN=HK3 PE=2 SV=1 911 1160 7.0E-15
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 1356 1499 8.0E-15
sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 911 1052 8.0E-15
sp|Q9C5U1|AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana GN=AHK3 PE=1 SV=1 911 1145 1.0E-14
sp|A1A698|OHK4_ORYSJ Probable histidine kinase 4 OS=Oryza sativa subsp. japonica GN=HK4 PE=2 SV=1 870 1048 2.0E-14
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 1351 1493 3.0E-14
sp|P0C0F7|RPFC_XANC8 Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpfC PE=3 SV=2 898 1149 3.0E-14
sp|P0C0F6|RPFC_XANCP Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpfC PE=1 SV=2 898 1149 3.0E-14
sp|A1A697|OHK5_ORYSJ Probable histidine kinase 5 OS=Oryza sativa subsp. japonica GN=HK5 PE=2 SV=1 911 1052 3.0E-14
sp|P20169|DSPA_SYNY3 Drug sensory protein A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dspA PE=3 SV=2 911 1143 4.0E-14
sp|O49187|ETR2_SOLLC Ethylene receptor 2 OS=Solanum lycopersicum GN=ETR2 PE=2 SV=1 917 1143 4.0E-14
sp|A1A699|OHK6_ORYSJ Probable histidine kinase 6 OS=Oryza sativa subsp. japonica GN=HK6 PE=1 SV=1 850 1052 5.0E-14
sp|A0QR01|SENX3_MYCS2 Signal-transduction histidine kinase senX3 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=senX3 PE=1 SV=1 909 1144 5.0E-14
sp|Q95PI2|DHKC_DICDI Hybrid signal transduction histidine kinase C OS=Dictyostelium discoideum GN=dhkC PE=1 SV=1 899 1137 1.0E-13
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 911 1145 1.0E-13
sp|P35164|RESE_BACSU Sensor histidine kinase ResE OS=Bacillus subtilis (strain 168) GN=resE PE=1 SV=1 906 1144 2.0E-13
sp|Q9C5U2|AHK2_ARATH Histidine kinase 2 OS=Arabidopsis thaliana GN=AHK2 PE=1 SV=1 911 1139 3.0E-13
sp|Q7A5H7|SRRB_STAAN Sensor protein SrrB OS=Staphylococcus aureus (strain N315) GN=srrB PE=1 SV=2 906 1144 3.0E-13
sp|Q99TZ9|SRRB_STAAM Sensor protein SrrB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=srrB PE=3 SV=2 906 1144 3.0E-13
sp|Q1XD95|YCF26_PYRYE Uncharacterized sensor-like histidine kinase ycf26 OS=Pyropia yezoensis GN=ycf26 PE=3 SV=1 896 1151 3.0E-13
sp|Q08430|KINB_BACSU Sporulation kinase B OS=Bacillus subtilis (strain 168) GN=kinB PE=3 SV=4 911 1144 3.0E-13
sp|Q8NWF3|SRRB_STAAW Sensor protein SrrB OS=Staphylococcus aureus (strain MW2) GN=srrB PE=3 SV=2 906 1144 3.0E-13
sp|Q6G973|SRRB_STAAS Sensor protein SrrB OS=Staphylococcus aureus (strain MSSA476) GN=srrB PE=3 SV=2 906 1144 3.0E-13
sp|Q5HFT1|SRRB_STAAC Sensor protein SrrB OS=Staphylococcus aureus (strain COL) GN=srrB PE=2 SV=1 906 1144 3.0E-13
sp|Q2FY80|SRRB_STAA8 Sensor protein SrrB OS=Staphylococcus aureus (strain NCTC 8325) GN=srrB PE=3 SV=1 906 1144 3.0E-13
sp|Q9L523|SRRB_STAAU Sensor protein SrrB OS=Staphylococcus aureus GN=srrB PE=2 SV=1 906 1144 3.0E-13
sp|Q6GGK7|SRRB_STAAR Sensor protein SrrB OS=Staphylococcus aureus (strain MRSA252) GN=srrB PE=3 SV=2 906 1144 4.0E-13
sp|Q8DMT2|SASA_THEEB Adaptive-response sensory-kinase SasA OS=Thermosynechococcus elongatus (strain BP-1) GN=sasA PE=3 SV=1 876 1144 4.0E-13
sp|Q9RDT3|WALK_STAAU Sensor protein kinase WalK (Fragment) OS=Staphylococcus aureus GN=walK PE=1 SV=1 891 1150 4.0E-13
sp|Q52969|Y1002_RHIME Uncharacterized sensor-like histidine kinase R01002 OS=Rhizobium meliloti (strain 1021) GN=R01002 PE=3 SV=2 904 1144 5.0E-13
sp|A2YFR6|OHK1_ORYSI Probable histidine kinase 1 OS=Oryza sativa subsp. indica GN=HK1 PE=3 SV=1 1335 1483 6.0E-13
sp|A3BE68|OHK1_ORYSJ Probable histidine kinase 1 OS=Oryza sativa subsp. japonica GN=HK1 PE=2 SV=1 1335 1483 6.0E-13
sp|O69729|TCRY_MYCTU Probable sensor histidine kinase TcrY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=tcrY PE=1 SV=1 909 1145 8.0E-13
sp|A5A2P0|WALK_STASR Sensor protein kinase WalK (Fragment) OS=Staphylococcus sciuri subsp. rodentium GN=walK PE=3 SV=1 898 1154 1.0E-12
sp|Q9ZHD4|SILS_SALTM Probable sensor kinase SilS OS=Salmonella typhimurium GN=silS PE=3 SV=1 913 1146 1.0E-12
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 911 1052 2.0E-12
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 1355 1479 3.0E-12
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 1355 1490 4.0E-12
sp|P51392|YCF26_PORPU Uncharacterized sensor-like histidine kinase ycf26 OS=Porphyra purpurea GN=ycf26 PE=3 SV=1 896 1150 5.0E-12
sp|P77485|CUSS_ECOLI Sensor kinase CusS OS=Escherichia coli (strain K12) GN=cusS PE=1 SV=1 884 1144 6.0E-12
sp|P9WGK5|SENX3_MYCTU Sensor-like histidine kinase senX3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=senX3 PE=1 SV=1 762 1147 1.0E-11
sp|P9WGK4|SENX3_MYCTO Sensor-like histidine kinase senX3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=senX3 PE=3 SV=1 762 1147 1.0E-11
sp|P0A601|SENX3_MYCBO Sensor-like histidine kinase senX3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=senX3 PE=3 SV=1 762 1147 1.0E-11
sp|B0JK50|SASA_MICAN Adaptive-response sensory-kinase SasA OS=Microcystis aeruginosa (strain NIES-843) GN=sasA PE=3 SV=1 862 1144 1.0E-11
sp|Q3S4A7|AHK5_ARATH Histidine kinase 5 OS=Arabidopsis thaliana GN=AHK5 PE=1 SV=1 1356 1483 2.0E-11
sp|A1A699|OHK6_ORYSJ Probable histidine kinase 6 OS=Oryza sativa subsp. japonica GN=HK6 PE=1 SV=1 1354 1485 2.0E-11
sp|P08400|PHOR_ECOLI Phosphate regulon sensor protein PhoR OS=Escherichia coli (strain K12) GN=phoR PE=1 SV=1 909 1151 2.0E-11
sp|P30847|BAES_ECOLI Signal transduction histidine-protein kinase BaeS OS=Escherichia coli (strain K12) GN=baeS PE=1 SV=2 889 1145 2.0E-11
sp|O48929|ETR1_TOBAC Ethylene receptor OS=Nicotiana tabacum GN=ETR1 PE=2 SV=1 911 1143 2.0E-11
sp|Q9RQQ9|DIVL_CAUCR Sensor protein DivL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=divL PE=1 SV=2 898 1144 3.0E-11
sp|Q8XBY4|CUSS_ECO57 Sensor kinase CusS OS=Escherichia coli O157:H7 GN=cusS PE=3 SV=1 884 1144 3.0E-11
sp|Q03069|DEGM_BACB2 Sensor protein DegM OS=Bacillus sp. (strain B21-2) GN=degM PE=3 SV=1 911 1144 3.0E-11
sp|B7K3M6|SASA_CYAP8 Adaptive-response sensory-kinase SasA OS=Cyanothece sp. (strain PCC 8801) GN=sasA PE=3 SV=1 896 1144 3.0E-11
sp|A1A698|OHK4_ORYSJ Probable histidine kinase 4 OS=Oryza sativa subsp. japonica GN=HK4 PE=2 SV=1 1354 1479 4.0E-11
sp|P45608|PHOR_KLEPN Phosphate regulon sensor protein PhoR OS=Klebsiella pneumoniae GN=phoR PE=3 SV=1 909 1144 4.0E-11
sp|O74539|MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak3 PE=1 SV=1 892 1046 4.0E-11
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 1356 1474 5.0E-11
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 1340 1479 6.0E-11
sp|A6QD58|WALK_STAAE Sensor protein kinase WalK OS=Staphylococcus aureus (strain Newman) GN=walK PE=3 SV=1 909 1150 6.0E-11
sp|Q9APE0|ZRAS_KLEOX Sensor protein ZraS OS=Klebsiella oxytoca GN=zraS PE=3 SV=1 898 1144 6.0E-11
sp|Q7A215|WALK_STAAW Sensor protein kinase WalK OS=Staphylococcus aureus (strain MW2) GN=walK PE=3 SV=1 909 1150 6.0E-11
sp|A8YYU2|WALK_STAAT Sensor protein kinase WalK OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=walK PE=3 SV=1 909 1150 6.0E-11
sp|Q6GD71|WALK_STAAS Sensor protein kinase WalK OS=Staphylococcus aureus (strain MSSA476) GN=walK PE=3 SV=1 909 1150 6.0E-11
sp|Q7A8E0|WALK_STAAN Sensor protein kinase WalK OS=Staphylococcus aureus (strain N315) GN=walK PE=1 SV=1 909 1150 6.0E-11
sp|Q7A305|WALK_STAAM Sensor protein kinase WalK OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=walK PE=3 SV=1 909 1150 6.0E-11
sp|Q5HJX6|WALK_STAAC Sensor protein kinase WalK OS=Staphylococcus aureus (strain COL) GN=walK PE=3 SV=1 909 1150 6.0E-11
sp|Q2YUQ2|WALK_STAAB Sensor protein kinase WalK OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=walK PE=3 SV=1 909 1150 6.0E-11
sp|A5INR0|WALK_STAA9 Sensor protein kinase WalK OS=Staphylococcus aureus (strain JH9) GN=walK PE=3 SV=1 909 1150 6.0E-11
sp|Q2G2U4|WALK_STAA8 Sensor protein kinase WalK OS=Staphylococcus aureus (strain NCTC 8325) GN=walK PE=1 SV=1 909 1150 6.0E-11
sp|Q2FKN7|WALK_STAA3 Sensor protein kinase WalK OS=Staphylococcus aureus (strain USA300) GN=walK PE=3 SV=1 909 1150 6.0E-11
sp|A6TXG9|WALK_STAA2 Sensor protein kinase WalK OS=Staphylococcus aureus (strain JH1) GN=walK PE=3 SV=1 909 1150 6.0E-11
sp|A7WWQ7|WALK_STAA1 Sensor protein kinase WalK OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=walK PE=3 SV=1 909 1150 6.0E-11
sp|Q4LAJ8|WALK_STAHJ Sensor protein kinase WalK OS=Staphylococcus haemolyticus (strain JCSC1435) GN=walK PE=3 SV=1 909 1150 6.0E-11
sp|Q8FK37|CUSS_ECOL6 Sensor kinase CusS OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cusS PE=3 SV=1 884 1144 1.0E-10
sp|Q8CU87|WALK_STAES Sensor protein kinase WalK OS=Staphylococcus epidermidis (strain ATCC 12228) GN=walK PE=1 SV=1 909 1150 1.0E-10
sp|Q5HK19|WALK_STAEQ Sensor protein kinase WalK OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=walK PE=1 SV=1 909 1150 1.0E-10
sp|P54883|SEX3_MYCLE Sensor-like histidine kinase senX3 OS=Mycobacterium leprae (strain TN) GN=senX3 PE=3 SV=1 909 1144 2.0E-10
sp|Q55630|SASA_SYNY3 Adaptive-response sensory-kinase SasA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sasA PE=3 SV=1 896 1144 2.0E-10
sp|Q54SK5|DHKM_DICDI Hybrid signal transduction histidine kinase M OS=Dictyostelium discoideum GN=dhkM PE=3 SV=1 1358 1483 2.0E-10
sp|Q6GKS6|WALK_STAAR Sensor protein kinase WalK OS=Staphylococcus aureus (strain MRSA252) GN=walK PE=3 SV=1 909 1150 2.0E-10
sp|P0AE82|CPXA_ECOLI Sensor protein CpxA OS=Escherichia coli (strain K12) GN=cpxA PE=1 SV=1 911 1145 2.0E-10
sp|P0AE83|CPXA_ECOL6 Sensor protein CpxA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cpxA PE=3 SV=1 911 1145 2.0E-10
sp|P0AE84|CPXA_ECO57 Sensor protein CpxA OS=Escherichia coli O157:H7 GN=cpxA PE=3 SV=1 911 1145 2.0E-10
sp|Q9M8Y4|ARR22_ARATH Two-component response regulator ARR22 OS=Arabidopsis thaliana GN=ARR22 PE=2 SV=1 1355 1489 2.0E-10
sp|Q45614|YYCG_BACSU Sensor histidine kinase YycG OS=Bacillus subtilis (strain 168) GN=yycG PE=1 SV=1 909 1145 3.0E-10
sp|Q551X9|DHKF_DICDI Hybrid signal transduction histidine kinase F OS=Dictyostelium discoideum GN=dhkF PE=3 SV=1 1356 1483 5.0E-10
sp|P45609|PHOR_SHIDY Phosphate regulon sensor protein PhoR OS=Shigella dysenteriae GN=phoR PE=3 SV=1 909 1151 5.0E-10
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 1356 1484 6.0E-10
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 1358 1483 9.0E-10
sp|Q9P896|TCSA_EMENI Two-component system protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsA PE=3 SV=2 1229 1483 9.0E-10
sp|Q4A159|WALK_STAS1 Sensor protein kinase WalK OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=walK PE=3 SV=1 909 1150 1.0E-09
sp|P94414|YCLK_BACSU Sensor histidine kinase YclK OS=Bacillus subtilis (strain 168) GN=yclK PE=3 SV=1 906 1145 1.0E-09
sp|I1WSZ3|IRLS_BURP2 Sensor protein IrlS OS=Burkholderia pseudomallei (strain 1026b) GN=irlS PE=3 SV=1 913 1144 1.0E-09
sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 1355 1479 2.0E-09
sp|Q5AHA0|CHK1_CANAL Histidine protein kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHK1 PE=2 SV=1 1355 1491 2.0E-09
sp|Q75KW7|ORR41_ORYSJ Two-component response regulator ORR41 OS=Oryza sativa subsp. japonica GN=RR41 PE=3 SV=1 1351 1483 2.0E-09
sp|P0DMK6|IRLS_BURPS Sensor protein IrlS OS=Burkholderia pseudomallei (strain K96243) GN=irlS PE=3 SV=1 913 1144 2.0E-09
sp|P58662|RCSC_SALTY Sensor histidine kinase RcsC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rcsC PE=3 SV=1 1348 1494 3.0E-09
sp|Q56128|RCSC_SALTI Sensor histidine kinase RcsC OS=Salmonella typhi GN=rcsC PE=3 SV=2 1348 1494 3.0E-09
sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 1334 1481 3.0E-09
sp|P71380|PHOR_HAEIN Phosphate regulon sensor protein PhoR OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=phoR PE=3 SV=1 911 1144 3.0E-09
sp|Q55434|PHY2_SYNY3 Phytochrome-like protein cph2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cph2 PE=1 SV=1 524 678 3.0E-09
sp|A2YFR6|OHK1_ORYSI Probable histidine kinase 1 OS=Oryza sativa subsp. indica GN=HK1 PE=3 SV=1 909 1052 4.0E-09
sp|A3BE68|OHK1_ORYSJ Probable histidine kinase 1 OS=Oryza sativa subsp. japonica GN=HK1 PE=2 SV=1 909 1052 4.0E-09
sp|O34206|KINB_PSEAI Alginate biosynthesis sensor protein KinB OS=Pseudomonas aeruginosa GN=kinB PE=1 SV=1 915 1144 4.0E-09
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 1356 1483 5.0E-09
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 1358 1479 6.0E-09
sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase BarA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 1338 1484 7.0E-09
sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=barA PE=1 SV=1 1338 1484 7.0E-09
sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 1338 1484 7.0E-09
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 1358 1483 8.0E-09
sp|P37461|ZRAS_SALTY Sensor protein ZraS OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=zraS PE=2 SV=2 911 1146 9.0E-09
sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase BarA OS=Shigella flexneri GN=barA PE=3 SV=1 1338 1484 1.0E-08
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 1345 1474 1.0E-08
sp|Q08408|RPRX_BACFR Sensor protein RprX OS=Bacteroides fragilis (strain YCH46) GN=rprX PE=3 SV=2 883 1149 1.0E-08
sp|Q8Z332|ZRAS_SALTI Sensor protein ZraS OS=Salmonella typhi GN=zraS PE=3 SV=1 911 1146 1.0E-08
sp|P9WGK8|MTRB_MYCTO Sensor histidine kinase MtrB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mtrB PE=3 SV=1 882 1146 1.0E-08
sp|P59963|MTRB_MYCBO Sensor histidine kinase MtrB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mtrB PE=3 SV=1 882 1146 1.0E-08
sp|A2WYI4|OHK3_ORYSI Probable histidine kinase 3 OS=Oryza sativa subsp. indica GN=HK3 PE=2 SV=1 1338 1479 2.0E-08
sp|P9WGK9|MTRB_MYCTU Sensor histidine kinase MtrB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mtrB PE=1 SV=1 882 1146 2.0E-08
sp|P14377|ZRAS_ECOLI Sensor protein ZraS OS=Escherichia coli (strain K12) GN=zraS PE=1 SV=2 911 1144 2.0E-08
sp|O22267|CKI1_ARATH Histidine kinase CKI1 OS=Arabidopsis thaliana GN=CKI1 PE=1 SV=1 912 1186 2.0E-08
sp|P0DMC5|RCSC_ECOLI Sensor histidine kinase RcsC OS=Escherichia coli (strain K12) GN=rcsC PE=1 SV=1 1308 1483 3.0E-08
sp|A1A696|OHK3_ORYSJ Probable histidine kinase 3 OS=Oryza sativa subsp. japonica GN=HK3 PE=2 SV=1 1338 1479 3.0E-08
sp|A5W4E3|TODS_PSEP1 Sensor histidine kinase TodS OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todS PE=1 SV=1 879 1145 3.0E-08
sp|E0X9C7|TODS_PSEPT Sensor histidine kinase TodS OS=Pseudomonas putida (strain DOT-T1E) GN=todS PE=1 SV=1 879 1145 3.0E-08
sp|P38889|SKN7_YEAST Transcription factor SKN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKN7 PE=1 SV=1 1354 1484 3.0E-08
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 1355 1483 4.0E-08
sp|Q9CCJ1|MTRB_MYCLE Sensor histidine kinase MtrB OS=Mycobacterium leprae (strain TN) GN=mtrB PE=3 SV=1 896 1146 5.0E-08
sp|Q2JKD9|SASA_SYNJB Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=sasA PE=3 SV=1 911 1144 6.0E-08
sp|Q9SXL4|AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana GN=AHK1 PE=1 SV=2 1354 1498 8.0E-08
sp|Q93CB7|MTRB_MYCPA Sensor histidine kinase MtrB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mtrB PE=3 SV=1 896 1146 1.0E-07
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 889 1060 1.0E-07
sp|P9WGK7|PRRB_MYCTU Sensor-type histidine kinase PrrB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=prrB PE=1 SV=1 876 1144 1.0E-07
sp|P9WGK6|PRRB_MYCTO Sensor-type histidine kinase PrrB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=prrB PE=3 SV=1 876 1144 1.0E-07
sp|P0A5Z9|PRRB_MYCBO Sensor-type histidine kinase PrrB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=prrB PE=3 SV=1 876 1144 1.0E-07
sp|Q9C5U1|AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana GN=AHK3 PE=1 SV=1 1354 1481 2.0E-07
sp|Q7A0W5|ARLS_STAAW Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MW2) GN=arlS PE=3 SV=1 874 1141 2.0E-07
sp|Q6G9E7|ARLS_STAAS Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MSSA476) GN=arlS PE=3 SV=1 874 1141 2.0E-07
sp|Q6GGZ4|ARLS_STAAR Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MRSA252) GN=arlS PE=3 SV=1 874 1141 2.0E-07
sp|Q7A5N3|ARLS_STAAN Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain N315) GN=arlS PE=1 SV=1 874 1141 2.0E-07
sp|Q7A2R7|ARLS_STAAM Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=arlS PE=3 SV=1 874 1141 2.0E-07
sp|Q5HG05|ARLS_STAAC Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain COL) GN=arlS PE=3 SV=1 874 1141 2.0E-07
sp|Q2YY04|ARLS_STAAB Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=arlS PE=3 SV=1 874 1141 2.0E-07
sp|Q9KJN3|ARLS_STAA8 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain NCTC 8325) GN=arlS PE=1 SV=1 874 1141 2.0E-07
sp|Q2FH24|ARLS_STAA3 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain USA300) GN=arlS PE=3 SV=1 874 1141 2.0E-07
sp|E5KK10|FILI_METH6 Methanogenesis regulatory histidine kinase FilI OS=Methanosaeta harundinacea (strain 6Ac) GN=filI PE=1 SV=1 896 1144 2.0E-07
sp|Q5SML4|OHK2_ORYSJ Probable histidine kinase 2 OS=Oryza sativa subsp. japonica GN=HK2 PE=2 SV=1 1353 1491 2.0E-07
sp|A2YA15|OHK2_ORYSI Probable histidine kinase 2 OS=Oryza sativa subsp. indica GN=HK2 PE=3 SV=1 1353 1491 2.0E-07
sp|B7KFU0|SASA_CYAP7 Adaptive-response sensory-kinase SasA OS=Cyanothece sp. (strain PCC 7424) GN=sasA PE=3 SV=1 881 1146 2.0E-07
sp|Q8X614|ZRAS_ECO57 Sensor protein ZraS OS=Escherichia coli O157:H7 GN=zraS PE=3 SV=1 911 1144 2.0E-07
sp|P0DMC6|RCSC_ECOLX Sensor histidine kinase RcsC OS=Escherichia coli GN=rcsC PE=1 SV=1 1308 1483 3.0E-07
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 911 1146 3.0E-07
sp|Q0IBF4|SASA_SYNS3 Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain CC9311) GN=sasA PE=3 SV=1 911 1172 3.0E-07
sp|Q8KIY1|TMOS_PSEME Sensor histidine kinase TmoS OS=Pseudomonas mendocina GN=tmoS PE=1 SV=1 883 1145 3.0E-07
sp|A8G5E7|SASA_PROM2 Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9215) GN=sasA PE=3 SV=1 839 1144 3.0E-07
sp|A7HD43|GCHK_ANADF Globin-coupled histidine kinase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=gchK PE=1 SV=1 883 1144 3.0E-07
sp|P0A4I6|CIAH_STRR6 Sensor protein CiaH OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ciaH PE=3 SV=1 902 1143 4.0E-07
sp|P0A4I5|CIAH_STRPN Sensor protein CiaH OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ciaH PE=3 SV=1 902 1143 4.0E-07
sp|O74539|MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak3 PE=1 SV=1 1354 1484 5.0E-07
sp|P42245|YCBM_BACSU Sensor histidine kinase YcbM OS=Bacillus subtilis (strain 168) GN=ycbM PE=3 SV=2 911 1143 5.0E-07
sp|A1A697|OHK5_ORYSJ Probable histidine kinase 5 OS=Oryza sativa subsp. japonica GN=HK5 PE=2 SV=1 1333 1479 7.0E-07
sp|O33071|PRRB_MYCLE Sensor-type histidine kinase PrrB OS=Mycobacterium leprae (strain TN) GN=prrB PE=3 SV=1 876 1143 7.0E-07
sp|B1WYT4|SASA_CYAA5 Adaptive-response sensory-kinase SasA OS=Cyanothece sp. (strain ATCC 51142) GN=sasA PE=3 SV=1 896 1144 8.0E-07
sp|Q742C0|MPRB_MYCPA Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mprB PE=3 SV=2 911 1144 8.0E-07
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 1358 1484 1.0E-06
sp|A7N6S2|CQSS_VIBCB CAI-1 autoinducer sensor kinase/phosphatase CqsS OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cqsS PE=1 SV=1 913 1479 1.0E-06
sp|A2C884|SASA_PROM3 Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9303) GN=sasA PE=3 SV=1 916 1144 1.0E-06
sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain YJ016) GN=luxQ PE=3 SV=1 1354 1484 2.0E-06
sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 1354 1484 2.0E-06
sp|Q7V6P7|SASA_PROMM Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9313) GN=sasA PE=3 SV=1 916 1144 3.0E-06
sp|Q9P4U6|TCSB_EMENI Two-component system protein B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsB PE=1 SV=2 1344 1483 3.0E-06
sp|P34094|PHYB_SOLTU Phytochrome B OS=Solanum tuberosum GN=PHYB PE=3 SV=2 912 1143 4.0E-06
sp|Q9C5U2|AHK2_ARATH Histidine kinase 2 OS=Arabidopsis thaliana GN=AHK2 PE=1 SV=1 1356 1475 4.0E-06
sp|Q9ZTP3|EIN4_ARATH Protein EIN4 OS=Arabidopsis thaliana GN=EIN4 PE=1 SV=1 1354 1474 4.0E-06
sp|P39664|SPHS_SYNE7 Sensor protein SphS OS=Synechococcus elongatus (strain PCC 7942) GN=sphS PE=1 SV=2 912 1144 4.0E-06
sp|O31671|KIND_BACSU Sporulation kinase D OS=Bacillus subtilis (strain 168) GN=kinD PE=1 SV=1 897 1144 4.0E-06
sp|Q9ZS62|PHYB1_SOLLC Phytochrome B1 OS=Solanum lycopersicum GN=PHYB1 PE=2 SV=1 912 1143 5.0E-06
sp|Q06067|ATOS_ECOLI Signal transduction histidine-protein kinase AtoS OS=Escherichia coli (strain K12) GN=atoS PE=3 SV=1 911 1145 5.0E-06
sp|Q7V113|SASA_PROMP Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=sasA PE=3 SV=1 911 1144 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009584 detection of visible light Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0018298 obsolete protein-chromophore linkage Yes
GO:0000160 phosphorelay signal transduction system Yes
GO:0005515 protein binding Yes
GO:0007165 signal transduction Yes
GO:0000155 phosphorelay sensor kinase activity Yes
GO:0009582 detection of abiotic stimulus No
GO:0004673 protein histidine kinase activity No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0035556 intracellular signal transduction No
GO:0010468 regulation of gene expression No
GO:0009605 response to external stimulus No
GO:0004672 protein kinase activity No
GO:0065007 biological regulation No
GO:0009583 detection of light stimulus No
GO:0016775 phosphotransferase activity, nitrogenous group as acceptor No
GO:0050896 response to stimulus No
GO:0031323 regulation of cellular metabolic process No
GO:0050794 regulation of cellular process No
GO:0019222 regulation of metabolic process No
GO:0060255 regulation of macromolecule metabolic process No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0140299 small molecule sensor activity No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No
GO:0003824 catalytic activity No
GO:0009581 detection of external stimulus No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0051606 detection of stimulus No
GO:2001141 regulation of RNA biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050789 regulation of biological process No
GO:0140096 catalytic activity, acting on a protein No
GO:0016301 kinase activity No
GO:0009889 regulation of biosynthetic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0080090 regulation of primary metabolic process No
GO:0009416 response to light stimulus No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0009314 response to radiation No
GO:0009628 response to abiotic stimulus No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 27.80 15.02 40.57
CcL In ants, during behavior modification 7.30 3.53 11.06
CcD In ants, recently dead 8.23 4.07 12.39

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.674346 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4324
MAAAGNSRQPAGPGSPSPGLFKVARLVRYLPSTYTDGPALVGRAAGCYRQGRSKEPCHLRSRIFLLAPVAGALAM
DEVREKQPSSPDADSDGIGATPRRSTRSRPFSADLSSPFPSLGQSPPPASAAADIGQRQLVTSPDPVSSWSTSSE
QQMCTRSAASDISNDRVFPIRSVVSVAPTPRFPSHSVDDYFALPADADPRATPTRSRPHHPRQAPFSTDSHPLSA
SEAISGSRRPWPRRKRPLSGPLSSIQADAARKGTIGPLNLAISASDSDSDDSAPRQPRSAAARVSAPVRGTASAA
SGHRSLSDMPHVYTRFTHVLTEGGHSVITGRDGVLQRCEDEPIHTPGAIQGFGVLLALREEIDGSFIVRYASENS
DKMLGYGPKQLFQLTNFMDILTEEQQDNLLDHIDFIRDEDADPSANGPEVLSLSIRHPKRRRSVKLWCAIHINPA
HPDLIICEFERDDDKDFPLRPTDELTPDVPHDTLHSNPNLEEIEESTEVLSKPLRILRSARKRRGEQGAMQVFDI
MSQVQEQLASASNLDNFLKILVGIFKELTGFHRVMIYQFDSSFNGKVVTELVDTSQTLDLYKGLNFPASDIPRQA
RDLYKINKVRLLYDRDLETARIVCRSAEDLEVPLDMTHAYLRAMSPIHLKYLGNMAVRSSMSISINAFDELWGLI
ACHSYGSHGMRVSFPIRKMCRLVGDTASRNIERLSYASRLQARKLINTAPTESNPTGYIIASSDDLLKLFDADFG
LLSIRGEAKVLGVLEQSQEALAMLEYLRMRSLTAVVTSQDITEDFPDLRYSLGFQVIAGLLYVPLSVGGHDFIVF
FRKGQVREVKWAGNPYEKTIRQGTSGYLEPRSSFKTWRETVMGKCREWNEEQVETAAVLCLVYGKFIEVWRQKEA
ALQNSKLTRLLLANSAHEVRTPLNAIINYLEIALEGTLDQETRENLARSHSASKSLIYVINDLLDLTKTEEGQNL
IKDEVFDLVACLQEATGPFHIDAKRKSIGFSVRHNPGLPRLVHGDGRRVRQAISNVTANAVAHTQAGSVDVEMLV
VEVRDGQVIVEIIVTDSGIGMSPQQLDALFRELEQVSSESETEPKSAEDDSEAHGARTLGLGLALVARIVRNMNG
QLRLKSEPSQGSRFVVQLPFLLADDSLGNDSASRDVAETEAEIKAEPEAVASATDSLKGEIMLVDCGRPGHANVE
EGATFGPDDASGKSRHSIGSKDSRGSDADRLINAIQTPLSLTDNQVGYFGNVPGSGCSSGRGAPRASIGGVPLSP
TPTTRKFAALTASRHEPGTEEIRDSKTPLRAIKVPDEYKDMETAPQESRVLYEVDEDSGRRPCRSKSIVSAATTD
ASNGLRTLVAEDDPINMKLLSKRLQKAGHEVHHAVNGEDCATVYKDDSSSFDVILMDMQMPIVDGLTSTKMIRSI
EGTDEHKGYSRLASLNGRVPIFAVSASLLEREKQTYIDAGFDGWILKPIDFKRLNKLLLGIHDGETRSTCLYAEG
QWERGGWFVMPSDVSACTTASDDTTPRAEETTTC
Coding >Ophio5|4324
ATGGCAGCGGCGGGCAATAGCAGGCAGCCAGCAGGGCCAGGCAGCCCAAGCCCAGGCTTGTTCAAGGTAGCCCGG
TTAGTACGGTACTTACCTTCTACCTACACAGACGGTCCGGCCCTGGTAGGTCGAGCTGCGGGCTGCTACAGGCAG
GGACGATCCAAGGAGCCGTGTCACCTCCGCTCCCGCATTTTCCTACTCGCTCCGGTCGCCGGTGCGCTCGCCATG
GACGAAGTGCGCGAGAAGCAGCCGTCGTCGCCGGACGCCGACAGCGACGGCATCGGCGCCACTCCGCGACGAAGC
ACCCGCTCCAGACCCTTCAGTGCCGATCTCTCGTCGCCCTTCCCTTCGCTCGGCCAGTCACCGCCACCCGCCTCA
GCCGCTGCCGACATTGGCCAGCGGCAGCTCGTCACAAGTCCTGATCCCGTCTCCTCGTGGAGTACCAGCTCCGAA
CAGCAAATGTGCACCCGCTCCGCCGCCTCGGACATCTCCAACGACCGCGTCTTCCCCATCCGTTCCGTTGTCAGC
GTCGCTCCGACTCCTAGGTTCCCTTCCCACTCTGTTGACGACTACTTCGCCTTGCCAGCCGATGCAGACCCTCGC
GCCACCCCGACGCGCAGTCGCCCTCACCATCCTCGACAGGCTCCCTTTTCCACCGACTCTCACCCCTTGTCCGCC
TCCGAGGCCATCTCCGGCAGCCGTCGGCCCTGGCCTCGCCGCAAGAGGCCGCTGAGCGGTCCCTTGTCCAGCATC
CAGGCCGACGCCGCTCGCAAGGGCACCATCGGCCCGCTGAACCTGGCCATATCCGCCTCCGACTCCGACTCCGAC
GACTCGGCCCCTAGGCAGCCCCGATCCGCCGCCGCCAGAGTTTCTGCTCCAGTTCGCGGGACCGCGTCGGCTGCA
TCTGGCCATCGGTCTCTGTCCGACATGCCGCACGTCTACACGCGCTTCACCCACGTCCTGACCGAAGGCGGCCAC
TCCGTCATCACGGGCCGAGACGGTGTTCTCCAGCGTTGCGAAGACGAGCCCATTCACACTCCCGGCGCCATCCAG
GGCTTCGGTGTACTCCTAGCCCTCAGGGAGGAAATCGATGGAAGCTTCATCGTCCGCTACGCGAGCGAGAACTCA
GACAAGATGCTCGGCTATGGCCCCAAGCAGCTATTTCAGCTTACCAACTTCATGGATATCTTAACCGAGGAGCAG
CAGGATAATCTGCTCGACCACATCGACTTCATCCGCGACGAGGACGCCGACCCCTCCGCTAACGGTCCCGAGGTT
CTCAGCCTCTCCATTCGCCATCCCAAGAGGAGGCGCAGTGTCAAGCTCTGGTGCGCCATCCACATTAACCCTGCC
CACCCGGACCTCATCATCTGCGAGTTCGAGCGAGACGACGACAAAGATTTTCCCCTCCGTCCAACTGACGAGCTG
ACGCCCGACGTCCCGCACGATACCCTGCACTCGAATCCGAACCTCGAGGAGATTGAGGAGAGCACCGAGGTCCTG
AGCAAGCCATTGCGTATCTTGCGAAGCGCCAGGAAACGGAGGGGCGAGCAAGGCGCCATGCAGGTCTTTGACATC
ATGTCCCAGGTTCAGGAGCAGCTCGCCTCGGCCTCCAACCTCGACAACTTTCTCAAGATTCTCGTCGGTATCTTC
AAGGAGCTGACCGGCTTCCACCGCGTCATGATTTACCAGTTCGACTCGTCCTTCAACGGCAAGGTCGTCACCGAA
CTCGTCGACACATCCCAGACTTTGGATCTCTACAAGGGTCTCAACTTCCCGGCCTCGGACATCCCCCGTCAAGCC
CGCGATCTCTACAAGATTAATAAGGTGCGGCTGCTCTACGATCGGGATCTCGAGACGGCCAGGATCGTCTGCCGC
TCTGCCGAGGACCTCGAGGTTCCCTTGGACATGACGCACGCCTATCTCAGGGCCATGTCGCCCATTCACCTCAAG
TACCTGGGCAACATGGCCGTGCGGTCTTCCATGTCTATCTCCATCAACGCTTTCGACGAGCTCTGGGGGCTGATC
GCCTGCCACTCGTACGGGTCTCATGGCATGCGCGTGTCATTTCCCATTCGAAAGATGTGTCGGTTAGTTGGAGAC
ACCGCGTCTCGGAACATCGAGAGACTCTCGTACGCCTCGAGGCTTCAAGCTAGGAAGCTCATCAACACGGCGCCC
ACTGAAAGCAACCCCACCGGCTATATAATCGCCTCTTCCGACGACCTTCTCAAGCTCTTCGATGCCGACTTCGGC
CTTCTGTCCATCAGGGGTGAGGCCAAGGTGCTGGGCGTCTTGGAGCAGAGCCAGGAAGCGCTGGCCATGCTCGAA
TACCTCCGGATGCGGAGTCTGACGGCTGTGGTGACGTCCCAGGACATCACCGAGGACTTTCCTGATCTTCGGTAT
TCGCTCGGCTTCCAGGTCATCGCCGGCTTGCTCTACGTTCCGCTGAGCGTCGGCGGCCACGACTTTATCGTCTTC
TTCCGCAAGGGCCAGGTGAGGGAGGTCAAGTGGGCCGGCAACCCGTACGAGAAGACGATCCGACAGGGGACCTCG
GGTTACCTGGAGCCGCGCAGCAGCTTCAAGACATGGCGGGAGACGGTCATGGGCAAGTGCCGCGAGTGGAATGAG
GAGCAAGTCGAGACGGCTGCAGTGCTTTGTCTCGTATATGGCAAGTTCATCGAGGTCTGGAGACAAAAGGAGGCA
GCACTGCAAAACAGCAAGCTCACCCGACTGCTCCTCGCCAATTCGGCTCACGAGGTCCGGACGCCGCTCAACGCC
ATCATCAATTACCTGGAGATTGCGCTCGAGGGTACGCTCGACCAGGAGACGCGGGAGAACCTGGCACGTTCGCAC
TCGGCTTCCAAGTCTCTCATCTACGTCATCAACGATCTCCTCGATCTGACCAAAACGGAGGAGGGCCAGAATCTG
ATTAAGGACGAGGTATTTGACTTGGTGGCATGTCTGCAGGAAGCGACGGGGCCTTTCCACATCGACGCCAAGAGG
AAGAGCATCGGATTCAGCGTCAGGCATAATCCCGGCCTGCCCCGGCTCGTCCACGGGGATGGTCGCCGTGTTCGC
CAAGCCATATCCAACGTGACAGCCAACGCGGTCGCGCATACGCAGGCCGGGTCTGTCGACGTCGAAATGCTCGTC
GTCGAGGTGAGAGACGGTCAGGTCATCGTCGAGATCATTGTGACCGACTCGGGCATCGGCATGAGTCCGCAACAG
CTCGATGCCTTGTTCCGCGAGCTGGAGCAGGTCAGCAGTGAGTCGGAGACGGAGCCCAAGAGCGCCGAGGACGAT
AGCGAGGCTCACGGCGCGCGGACGCTGGGCCTCGGGCTCGCCCTTGTTGCACGCATCGTGAGGAACATGAACGGA
CAATTGCGGCTCAAATCGGAGCCGAGCCAGGGCTCAAGGTTTGTCGTTCAGCTACCGTTTCTCCTGGCCGACGAC
TCTCTCGGCAATGACAGCGCCTCCCGTGACGTGGCCGAGACGGAAGCGGAGATCAAAGCAGAGCCTGAAGCGGTT
GCGTCGGCGACGGACTCGCTCAAAGGCGAAATCATGCTCGTCGATTGCGGGCGCCCTGGCCACGCCAACGTGGAA
GAGGGCGCCACGTTCGGGCCTGACGACGCCAGCGGCAAGAGCCGGCATAGCATCGGCAGCAAGGACAGCCGCGGC
AGCGACGCGGATCGGCTCATCAACGCCATCCAGACGCCCCTTTCGCTGACCGACAACCAGGTGGGATACTTTGGC
AATGTGCCGGGCTCAGGCTGTAGTTCCGGCCGGGGCGCCCCACGAGCCAGCATCGGCGGCGTTCCGCTCTCTCCC
ACTCCGACGACTCGCAAGTTTGCGGCACTCACGGCGTCGCGGCACGAGCCCGGTACCGAGGAGATTCGCGACAGC
AAGACGCCGCTCCGGGCCATCAAAGTACCGGACGAGTACAAGGACATGGAGACGGCGCCGCAAGAGTCGCGCGTG
CTGTACGAGGTGGATGAAGACAGTGGGCGCAGGCCGTGTCGTAGCAAGAGCATCGTCAGCGCCGCGACGACGGAC
GCCAGCAACGGGCTCCGCACCCTGGTGGCCGAGGACGATCCGATCAACATGAAGCTACTCAGCAAGAGACTGCAG
AAGGCGGGCCACGAGGTTCACCATGCCGTCAATGGCGAGGACTGCGCGACGGTGTACAAGGACGATTCGTCGTCG
TTTGACGTGATTCTCATGGACATGCAGATGCCCATCGTCGACGGCCTTACTAGCACCAAGATGATCCGTTCGATC
GAGGGCACGGACGAACACAAGGGCTATTCACGGCTGGCGTCGCTCAATGGTCGCGTCCCTATCTTCGCCGTCTCG
GCCTCGTTGCTGGAGCGGGAGAAGCAGACGTACATTGACGCCGGCTTTGACGGCTGGATCCTGAAGCCGATTGAC
TTTAAGAGGCTCAATAAGCTGCTGCTGGGCATACATGATGGGGAAACGCGCAGCACATGCCTCTACGCCGAGGGC
CAGTGGGAACGTGGTGGCTGGTTTGTTATGCCGTCCGATGTGTCTGCCTGCACGACGGCGAGCGATGATACGACG
CCTCGGGCCGAGGAGACGACGACATGT
Transcript >Ophio5|4324
ATGGCAGCGGCGGGCAATAGCAGGCAGCCAGCAGGGCCAGGCAGCCCAAGCCCAGGCTTGTTCAAGGTAGCCCGG
TTAGTACGGTACTTACCTTCTACCTACACAGACGGTCCGGCCCTGGTAGGTCGAGCTGCGGGCTGCTACAGGCAG
GGACGATCCAAGGAGCCGTGTCACCTCCGCTCCCGCATTTTCCTACTCGCTCCGGTCGCCGGTGCGCTCGCCATG
GACGAAGTGCGCGAGAAGCAGCCGTCGTCGCCGGACGCCGACAGCGACGGCATCGGCGCCACTCCGCGACGAAGC
ACCCGCTCCAGACCCTTCAGTGCCGATCTCTCGTCGCCCTTCCCTTCGCTCGGCCAGTCACCGCCACCCGCCTCA
GCCGCTGCCGACATTGGCCAGCGGCAGCTCGTCACAAGTCCTGATCCCGTCTCCTCGTGGAGTACCAGCTCCGAA
CAGCAAATGTGCACCCGCTCCGCCGCCTCGGACATCTCCAACGACCGCGTCTTCCCCATCCGTTCCGTTGTCAGC
GTCGCTCCGACTCCTAGGTTCCCTTCCCACTCTGTTGACGACTACTTCGCCTTGCCAGCCGATGCAGACCCTCGC
GCCACCCCGACGCGCAGTCGCCCTCACCATCCTCGACAGGCTCCCTTTTCCACCGACTCTCACCCCTTGTCCGCC
TCCGAGGCCATCTCCGGCAGCCGTCGGCCCTGGCCTCGCCGCAAGAGGCCGCTGAGCGGTCCCTTGTCCAGCATC
CAGGCCGACGCCGCTCGCAAGGGCACCATCGGCCCGCTGAACCTGGCCATATCCGCCTCCGACTCCGACTCCGAC
GACTCGGCCCCTAGGCAGCCCCGATCCGCCGCCGCCAGAGTTTCTGCTCCAGTTCGCGGGACCGCGTCGGCTGCA
TCTGGCCATCGGTCTCTGTCCGACATGCCGCACGTCTACACGCGCTTCACCCACGTCCTGACCGAAGGCGGCCAC
TCCGTCATCACGGGCCGAGACGGTGTTCTCCAGCGTTGCGAAGACGAGCCCATTCACACTCCCGGCGCCATCCAG
GGCTTCGGTGTACTCCTAGCCCTCAGGGAGGAAATCGATGGAAGCTTCATCGTCCGCTACGCGAGCGAGAACTCA
GACAAGATGCTCGGCTATGGCCCCAAGCAGCTATTTCAGCTTACCAACTTCATGGATATCTTAACCGAGGAGCAG
CAGGATAATCTGCTCGACCACATCGACTTCATCCGCGACGAGGACGCCGACCCCTCCGCTAACGGTCCCGAGGTT
CTCAGCCTCTCCATTCGCCATCCCAAGAGGAGGCGCAGTGTCAAGCTCTGGTGCGCCATCCACATTAACCCTGCC
CACCCGGACCTCATCATCTGCGAGTTCGAGCGAGACGACGACAAAGATTTTCCCCTCCGTCCAACTGACGAGCTG
ACGCCCGACGTCCCGCACGATACCCTGCACTCGAATCCGAACCTCGAGGAGATTGAGGAGAGCACCGAGGTCCTG
AGCAAGCCATTGCGTATCTTGCGAAGCGCCAGGAAACGGAGGGGCGAGCAAGGCGCCATGCAGGTCTTTGACATC
ATGTCCCAGGTTCAGGAGCAGCTCGCCTCGGCCTCCAACCTCGACAACTTTCTCAAGATTCTCGTCGGTATCTTC
AAGGAGCTGACCGGCTTCCACCGCGTCATGATTTACCAGTTCGACTCGTCCTTCAACGGCAAGGTCGTCACCGAA
CTCGTCGACACATCCCAGACTTTGGATCTCTACAAGGGTCTCAACTTCCCGGCCTCGGACATCCCCCGTCAAGCC
CGCGATCTCTACAAGATTAATAAGGTGCGGCTGCTCTACGATCGGGATCTCGAGACGGCCAGGATCGTCTGCCGC
TCTGCCGAGGACCTCGAGGTTCCCTTGGACATGACGCACGCCTATCTCAGGGCCATGTCGCCCATTCACCTCAAG
TACCTGGGCAACATGGCCGTGCGGTCTTCCATGTCTATCTCCATCAACGCTTTCGACGAGCTCTGGGGGCTGATC
GCCTGCCACTCGTACGGGTCTCATGGCATGCGCGTGTCATTTCCCATTCGAAAGATGTGTCGGTTAGTTGGAGAC
ACCGCGTCTCGGAACATCGAGAGACTCTCGTACGCCTCGAGGCTTCAAGCTAGGAAGCTCATCAACACGGCGCCC
ACTGAAAGCAACCCCACCGGCTATATAATCGCCTCTTCCGACGACCTTCTCAAGCTCTTCGATGCCGACTTCGGC
CTTCTGTCCATCAGGGGTGAGGCCAAGGTGCTGGGCGTCTTGGAGCAGAGCCAGGAAGCGCTGGCCATGCTCGAA
TACCTCCGGATGCGGAGTCTGACGGCTGTGGTGACGTCCCAGGACATCACCGAGGACTTTCCTGATCTTCGGTAT
TCGCTCGGCTTCCAGGTCATCGCCGGCTTGCTCTACGTTCCGCTGAGCGTCGGCGGCCACGACTTTATCGTCTTC
TTCCGCAAGGGCCAGGTGAGGGAGGTCAAGTGGGCCGGCAACCCGTACGAGAAGACGATCCGACAGGGGACCTCG
GGTTACCTGGAGCCGCGCAGCAGCTTCAAGACATGGCGGGAGACGGTCATGGGCAAGTGCCGCGAGTGGAATGAG
GAGCAAGTCGAGACGGCTGCAGTGCTTTGTCTCGTATATGGCAAGTTCATCGAGGTCTGGAGACAAAAGGAGGCA
GCACTGCAAAACAGCAAGCTCACCCGACTGCTCCTCGCCAATTCGGCTCACGAGGTCCGGACGCCGCTCAACGCC
ATCATCAATTACCTGGAGATTGCGCTCGAGGGTACGCTCGACCAGGAGACGCGGGAGAACCTGGCACGTTCGCAC
TCGGCTTCCAAGTCTCTCATCTACGTCATCAACGATCTCCTCGATCTGACCAAAACGGAGGAGGGCCAGAATCTG
ATTAAGGACGAGGTATTTGACTTGGTGGCATGTCTGCAGGAAGCGACGGGGCCTTTCCACATCGACGCCAAGAGG
AAGAGCATCGGATTCAGCGTCAGGCATAATCCCGGCCTGCCCCGGCTCGTCCACGGGGATGGTCGCCGTGTTCGC
CAAGCCATATCCAACGTGACAGCCAACGCGGTCGCGCATACGCAGGCCGGGTCTGTCGACGTCGAAATGCTCGTC
GTCGAGGTGAGAGACGGTCAGGTCATCGTCGAGATCATTGTGACCGACTCGGGCATCGGCATGAGTCCGCAACAG
CTCGATGCCTTGTTCCGCGAGCTGGAGCAGGTCAGCAGTGAGTCGGAGACGGAGCCCAAGAGCGCCGAGGACGAT
AGCGAGGCTCACGGCGCGCGGACGCTGGGCCTCGGGCTCGCCCTTGTTGCACGCATCGTGAGGAACATGAACGGA
CAATTGCGGCTCAAATCGGAGCCGAGCCAGGGCTCAAGGTTTGTCGTTCAGCTACCGTTTCTCCTGGCCGACGAC
TCTCTCGGCAATGACAGCGCCTCCCGTGACGTGGCCGAGACGGAAGCGGAGATCAAAGCAGAGCCTGAAGCGGTT
GCGTCGGCGACGGACTCGCTCAAAGGCGAAATCATGCTCGTCGATTGCGGGCGCCCTGGCCACGCCAACGTGGAA
GAGGGCGCCACGTTCGGGCCTGACGACGCCAGCGGCAAGAGCCGGCATAGCATCGGCAGCAAGGACAGCCGCGGC
AGCGACGCGGATCGGCTCATCAACGCCATCCAGACGCCCCTTTCGCTGACCGACAACCAGGTGGGATACTTTGGC
AATGTGCCGGGCTCAGGCTGTAGTTCCGGCCGGGGCGCCCCACGAGCCAGCATCGGCGGCGTTCCGCTCTCTCCC
ACTCCGACGACTCGCAAGTTTGCGGCACTCACGGCGTCGCGGCACGAGCCCGGTACCGAGGAGATTCGCGACAGC
AAGACGCCGCTCCGGGCCATCAAAGTACCGGACGAGTACAAGGACATGGAGACGGCGCCGCAAGAGTCGCGCGTG
CTGTACGAGGTGGATGAAGACAGTGGGCGCAGGCCGTGTCGTAGCAAGAGCATCGTCAGCGCCGCGACGACGGAC
GCCAGCAACGGGCTCCGCACCCTGGTGGCCGAGGACGATCCGATCAACATGAAGCTACTCAGCAAGAGACTGCAG
AAGGCGGGCCACGAGGTTCACCATGCCGTCAATGGCGAGGACTGCGCGACGGTGTACAAGGACGATTCGTCGTCG
TTTGACGTGATTCTCATGGACATGCAGATGCCCATCGTCGACGGCCTTACTAGCACCAAGATGATCCGTTCGATC
GAGGGCACGGACGAACACAAGGGCTATTCACGGCTGGCGTCGCTCAATGGTCGCGTCCCTATCTTCGCCGTCTCG
GCCTCGTTGCTGGAGCGGGAGAAGCAGACGTACATTGACGCCGGCTTTGACGGCTGGATCCTGAAGCCGATTGAC
TTTAAGAGGCTCAATAAGCTGCTGCTGGGCATACATGATGGGGAAACGCGCAGCACATGCCTCTACGCCGAGGGC
CAGTGGGAACGTGGTGGCTGGTTTGTTATGCCGTCCGATGTGTCTGCCTGCACGACGGCGAGCGATGATACGACG
CCTCGGGCCGAGGAGACGACGACATGTTGA
Gene >Ophio5|4324
ATGGCAGCGGCGGGCAATAGCAGGCAGCCAGCAGGGCCAGGCAGCCCAAGCCCAGGCTTGTTCAAGGTAGCCCGG
TTAGTACGGTACTTACCTTCTACCTACACAGACGGTCCGGCCCTGGTAGGTCGAGCTGCGGGCTGCTACAGGCAG
GGACGATCCAAGGTCAGCACCCTGCGGCGACTCACCACCATAGATCAATCTTTGACCCGTTCATCAGGAGCCGTG
TCACCTCCGCTCCCGCATTTTCCTACTCGCTCCGGTCGATCTCTCACCTCCGGCCTGACGTCGCCCCGCTGCCGC
TGCCCATCTCATCGTGTCCGAGGCATGTGCGGATCCACGGCCTGTGTCTCGCATCTCGACCAGCCGTCCAACTCG
TCCAGCCGCCGCTGTGACTTCTAGGTCGCCGGTGCGCTCGCCATGGACGAAGTGCGCGAGAAGCAGCCGTCGTCG
CCGGACGCCGACAGCGACGGCATCGGCGCCACTCCGCGACGAAGCACCCGCTCCAGACCCTTCAGTGCCGATCTC
TCGTCGCCCTTCCCTTCGCTCGGCCAGTCACCGCCACCCGCCTCAGCCGCTGCCGACATTGGCCAGCGGCAGCTC
GTCACAAGTCCTGATCCCGTCTCCTCGTGGAGTACCAGCTCCGAACAGCAAATGTGCACCCGCTCCGCCGCCTCG
GACATCTCCAACGACCGCGTCTTCCCCATCCGTTCCGTTGTCAGCGTCGCTCCGACTCCTAGGTTCCCTTCCCAC
TCTGTTGACGACTACTTCGCCTTGCCAGCCGATGCAGACCCTCGCGCCACCCCGACGCGCAGTCGCCCTCACCAT
CCTCGACAGGCTCCCTTTTCCACCGACTCTCACCCCTTGTCCGCCTCCGAGGCCATCTCCGGCAGCCGTCGGCCC
TGGCCTCGCCGCAAGAGGCCGCTGAGCGGTCCCTTGTCCAGCATCCAGGCCGACGCCGCTCGCAAGGGCACCATC
GGCCCGCTGAACCTGGCCATATCCGCCTCCGACTCCGACTCCGACGACTCGGCCCCTAGGCAGCCCCGATCCGCC
GCCGCCAGAGTTTCTGCTCCAGTTCGCGGGACCGCGTCGGCTGCATCTGGCCATCGGTCTCTGTCCGACATGCCG
CACGTCTACACGCGCTTCACCCACGTCCTGACCGAAGGCGGCCACTCCGTCATCACGGGCCGAGACGGTGTTCTC
CAGCGTTGCGAAGACGAGCCCATTCACACTCCCGGCGCCATCCAGGGCTTCGGTGTACTCCTAGCCCTCAGGGAG
GAAATCGATGGAAGCTTCATCGTCCGCTACGCGAGCGAGAACTCAGACAAGATGCTCGGCTATGGCCCCAAGCAG
CTATTTCAGCTTACCAACTTCATGGATATCTTAACCGAGGAGCAGCAGGATAATCTGCTCGACCACATCGACTTC
ATCCGCGACGAGGACGCCGACCCCTCCGCTAACGGTCCCGAGGTTCTCAGCCTCTCCATTCGCCATCCCAAGAGG
AGGCGCAGTGTCAAGCTCTGGTGCGCCATCCACATTAACCCTGCCCACCCGGACCTCATCATCTGCGAGTTCGAG
CGAGACGACGACAAAGATTTTCCCCTCCGTCCAACTGACGAGCTGACGCCCGACGTCCCGCACGATACCCTGCAC
TCGAATCCGAACCTCGAGGAGATTGAGGAGAGCACCGAGGTCCTGAGCAAGCCATTGCGTATCTTGCGAAGCGCC
AGGAAACGGAGGGGCGAGCAAGGCGCCATGCAGGTCTTTGACATCATGTCCCAGGTTCAGGAGCAGCTCGCCTCG
GCCTCCAACCTCGACAACTTTCTCAAGATTCTCGTCGGTATCTTCAAGGAGCTGACCGGCTTCCACCGCGTCATG
ATTTACCAGTTCGACTCGTCCTTCAACGGCAAGGTCGTCACCGAACTCGTCGACACATCCCAGACTTTGGATCTC
TACAAGGGTCTCAACTTCCCGGCCTCGGACATCCCCCGTCAAGCCCGCGATCTCTACAAGATTAATAAGGTGCGG
CTGCTCTACGATCGGGATCTCGAGACGGCCAGGATCGTCTGCCGCTCTGCCGAGGACCTCGAGGTTCCCTTGGAC
ATGACGCACGCCTATCTCAGGGCCATGTCGCCCATTCACCTCAAGTACCTGGGCAACATGGCCGTGCGGTCTTCC
ATGTCTATCTCCATCAACGCTTTCGACGAGCTCTGGGGGCTGATCGCCTGCCACTCGTACGGGTCTCATGGCATG
CGCGTGTCATTTCCCATTCGAAAGATGTGTCGGTTAGTTGGAGACACCGCGTCTCGGAACATCGAGAGACTCTCG
TACGCCTCGAGGCTTCAAGCTAGGAAGCTCATCAACACGGCGCCCACTGAAAGCAACCCCACCGGCTATATAATC
GCCTCTTCCGACGACCTTCTCAAGCTCTTCGATGCCGACTTCGGCCTTCTGTCCATCAGGGGTGAGGCCAAGGTG
CTGGGCGTCTTGGAGCAGAGCCAGGAAGCGCTGGCCATGCTCGAATACCTCCGGATGCGGAGTCTGACGGCTGTG
GTGACGTCCCAGGACATCACCGAGGACTTTCCTGATCTTCGGTATTCGCTCGGCTTCCAGGTCATCGCCGGCTTG
CTCTACGTTCCGCTGAGCGTCGGCGGCCACGACTTTATCGTCTTCTTCCGCAAGGGCCAGGTGAGGGAGGTCAAG
TGGGCCGGCAACCCGTACGAGAAGACGATCCGACAGGGGACCTCGGGTTACCTGGAGCCGCGCAGCAGCTTCAAG
ACATGGCGGGAGACGGTCATGGGCAAGTGCCGCGAGTGGAATGAGGAGCAAGTCGAGACGGCTGCAGTGCTTTGT
CTCGTATATGGTGAGGACACTCTCTTCCTCTGGACATTCACTGGCAAAGGCTGATAACCCCCCGTCATAGGCAAG
TTCATCGAGGTCTGGAGACAAAAGGAGGCAGCACTGCAAAACAGCAAGCTCACCCGACTGCTCCTCGCCAATTCG
GCTCACGAGGTCCGGACGCCGCTCAACGCCATCATCAATTACCTGGAGATTGCGCTCGAGGGTACGCTCGACCAG
GAGACGCGGGAGAACCTGGCACGTTCGCACTCGGCTTCCAAGTCTCTCATCTACGTCATCAACGATCTCCTCGAT
CTGACCAAAACGGAGGAGGGCCAGAATCTGATTAAGGACGAGGTATTTGACTTGGTGGCATGTCTGCAGGAAGCG
ACGGGGCCTTTCCACATCGACGCCAAGAGGAAGAGCATCGGATTCAGCGTCAGGCATAATCCCGGCCTGCCCCGG
CTCGTCCACGGGGATGGTCGCCGTGTTCGCCAAGCCATATCCAACGTGACAGCCAACGCGGTCGCGCATACGCAG
GCCGGGTCTGTCGACGTCGAAATGCTCGTCGTCGAGGTGAGAGACGGTCAGGTCATCGTCGAGATCATTGTGACC
GACTCGGGCATCGGCATGAGTCCGCAACAGCTCGATGCCTTGTTCCGCGAGCTGGAGCAGGTCAGCAGTGAGTCG
GAGACGGAGCCCAAGAGCGCCGAGGACGATAGCGAGGCTCACGGCGCGCGGACGCTGGGCCTCGGGCTCGCCCTT
GTTGCACGCATCGTGAGGAACATGAACGGACAATTGCGGCTCAAATCGGAGCCGAGCCAGGGCTCAAGGTTTGTC
GTTCAGCTACCGTTTCTCCTGGCCGACGACTCTCTCGGCAATGACAGCGCCTCCCGTGACGTGGCCGAGACGGAA
GCGGAGATCAAAGCAGAGCCTGAAGCGGTTGCGTCGGCGACGGACTCGCTCAAAGGCGAAATCATGCTCGTCGAT
TGCGGGCGCCCTGGCCACGCCAACGTGGAAGAGGGCGCCACGTTCGGGCCTGACGACGCCAGCGGCAAGAGCCGG
CATAGCATCGGCAGCAAGGACAGCCGCGGCAGCGACGCGGATCGGCTCATCAACGCCATCCAGACGCCCCTTTCG
CTGACCGACAACCAGGTGGGATACTTTGGCAATGTGCCGGGCTCAGGCTGTAGTTCCGGCCGGGGCGCCCCACGA
GCCAGCATCGGCGGCGTTCCGCTCTCTCCCACTCCGACGACTCGCAAGTTTGCGGCACTCACGGCGTCGCGGCAC
GAGCCCGGTACCGAGGAGATTCGCGACAGCAAGACGCCGCTCCGGGCCATCAAAGTACCGGACGAGTACAAGGAC
ATGGAGACGGCGCCGCAAGAGTCGCGCGTGCTGTACGAGGTGGATGAAGACAGTGGGCGCAGGCCGTGTCGTAGC
AAGAGCATCGTCAGCGCCGCGACGACGGACGCCAGCAACGGGCTCCGCACCCTGGTGGCCGAGGACGATCCGATC
AACATGAAGCTACTCAGCAAGAGACTGCAGAAGGCGGGCCACGAGGTTCACCATGCCGTCAATGGCGAGGACTGC
GCGACGGTGTACAAGGACGATTCGTCGTCGTTTGACGTGATTCTCATGGACATGCAGGTGAGTGGTGGCCAGTTG
TCTCCCTTCCCCCCCTATTTGCCGTAGCGACCAGCTAACAAGGGGGACGAAAAAGATGCCCATCGTCGACGGCCT
TACTAGCACCAAGATGATCCGTTCGATCGAGGGCACGGACGAACACAAGGGCTATTCACGGCTGGCGTCGCTCAA
TGGTCGCGTCCCTATCTTCGCCGTCTCGGCCTCGTTGCTGGAGCGGGAGAAGCAGACGTACATTGACGCCGGCTT
TGACGGCTGGATCCTGAAGCCGATTGACTTTAAGAGGCTCAATAAGCTGCTGCTGGGCATACATGATGGGGAAAC
GCGCAGCACATGCCTCTACGCCGAGGGCCAGTGGGAACGTGGTGGCTGGTTTGTTATGCCGTCCGATGTGTCTGC
CTGCACGACGGCGAGCGATGATACGACGCCTCGGGCCGAGGAGACGACGACATGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail