Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4315
Gene name
Locationscaffold_340:6182..6533
Strand+
Gene length (bp)351
Transcript length (bp)225
Coding sequence length (bp)222
Protein length (aa) 74

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09813 Coa3_cc Cytochrome c oxidase assembly factor 3 2.5E-13 20 60

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A5DLM7|COA3_PICGU Cytochrome c oxidase assembly factor 3, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=COA3 PE=3 SV=2 6 64 6.0E-09
sp|B9WK46|COA3_CANDC Cytochrome c oxidase assembly factor 3, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=COA3 PE=3 SV=1 6 64 9.0E-09
sp|C4YTL7|COA3_CANAW Cytochrome c oxidase assembly factor 3, mitochondrial OS=Candida albicans (strain WO-1) GN=COA3 PE=3 SV=1 6 64 9.0E-09
sp|Q6CHT7|COA3_YARLI Cytochrome c oxidase assembly factor 3, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COA3 PE=3 SV=1 12 64 2.0E-08
sp|Q6BL60|COA3_DEBHA Cytochrome c oxidase assembly factor 3, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=COA3 PE=3 SV=1 6 64 4.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A5DLM7|COA3_PICGU Cytochrome c oxidase assembly factor 3, mitochondrial OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=COA3 PE=3 SV=2 6 64 6.0E-09
sp|B9WK46|COA3_CANDC Cytochrome c oxidase assembly factor 3, mitochondrial OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=COA3 PE=3 SV=1 6 64 9.0E-09
sp|C4YTL7|COA3_CANAW Cytochrome c oxidase assembly factor 3, mitochondrial OS=Candida albicans (strain WO-1) GN=COA3 PE=3 SV=1 6 64 9.0E-09
sp|Q6CHT7|COA3_YARLI Cytochrome c oxidase assembly factor 3, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COA3 PE=3 SV=1 12 64 2.0E-08
sp|Q6BL60|COA3_DEBHA Cytochrome c oxidase assembly factor 3, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=COA3 PE=3 SV=1 6 64 4.0E-08
sp|A5E7J0|COA3_LODEL Cytochrome c oxidase assembly factor 3, mitochondrial OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=COA3 PE=3 SV=1 18 64 2.0E-07
sp|C5E368|COA3_LACTC Cytochrome c oxidase assembly factor 3, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=COA3 PE=3 SV=1 12 64 2.0E-07
sp|C4YBX9|COA3_CLAL4 Cytochrome c oxidase assembly factor 3, mitochondrial OS=Clavispora lusitaniae (strain ATCC 42720) GN=COA3 PE=3 SV=1 6 64 2.0E-07
sp|Q758B5|COA3_ASHGO Cytochrome c oxidase assembly factor 3, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=COA3 PE=3 SV=1 12 64 1.0E-06
sp|A3LWK1|COA3_PICST Cytochrome c oxidase assembly factor 3, mitochondrial OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=COA3 PE=3 SV=1 6 64 2.0E-06
sp|Q6CLM9|COA3_KLULA Cytochrome c oxidase assembly factor 3, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=COA3 PE=3 SV=1 12 64 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 28 50 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 187.92 69.85 305.99
CcL In ants, during behavior modification 134.88 39.43 230.34
CcD In ants, recently dead 191.23 71.55 310.91

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.339929 no
SC16a CcD 0.964294 no
CcL CcD 0.316164 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4315
MYNHPHHTYYDRRLRQGPALIRARRPYLLRNTLTGLGLFSITVAIYIYTIKAVGQDEFADVKVPDAPQAPAGKE
Coding >Ophio5|4315
ATGTACAACCACCCGCATCACACATATTACGACCGCCGGCTGAGGCAAGGCCCAGCCCTCATACGAGCTCGTCGA
CCCTATCTGCTCCGGAACACTCTTACGGGTCTGGGCTTGTTCAGCATCACTGTAGCCATCTACATCTACACGATC
AAGGCCGTCGGCCAAGACGAATTCGCCGATGTCAAGGTGCCTGATGCTCCCCAGGCACCGGCCGGCAAGGAA
Transcript >Ophio5|4315
ATGTACAACCACCCGCATCACACATATTACGACCGCCGGCTGAGGCAAGGCCCAGCCCTCATACGAGCTCGTCGA
CCCTATCTGCTCCGGAACACTCTTACGGGTCTGGGCTTGTTCAGCATCACTGTAGCCATCTACATCTACACGATC
AAGGCCGTCGGCCAAGACGAATTCGCCGATGTCAAGGTGCCTGATGCTCCCCAGGCACCGGCCGGCAAGGAATAG
Gene >Ophio5|4315
ATGTACAACCAGTAAGCGCCTCACGCTCTGTCTGTGACAGCCGGCAGAATGCTCATCCTCCGCCCCTTCCCAGCC
CGCATCACACATATTACGACCGCCGGCTGAGGCAAGGCCCAGCCCTCATACGAGCTCGTCGACCCTATCTGCTCC
GGAACACTCTTACGGGTCTGGGCTTGTTCAGCATCACTGTAGCCATCTGTAAGCTTCGGCGTGCTTGTCGAGACT
CACGGCGCAGGAACAGGGTGCTCATCGGTCGCCGCAGACATCTACACGATCAAGGCCGTCGGCCAAGACGAATTC
GCCGATGTCAAGGTGCCTGATGCTCCCCAGGCACCGGCCGGCAAGGAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail