Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|43
Gene name
Locationscaffold_1:99057..100533
Strand+
Gene length (bp)1476
Transcript length (bp)1341
Coding sequence length (bp)1338
Protein length (aa) 446

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00899 ThiF ThiF family 2.8E-51 47 294
PF00581 Rhodanese Rhodanese-like domain 7.0E-11 337 436

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A4RPM5|UBA4_MAGO7 Adenylyltransferase and sulfurtransferase uba4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=UBA4 PE=3 SV=1 3 446 1.0E-168
sp|O59954|UBA4_EMENI Adenylyltransferase and sulfurtransferase uba4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uba4 PE=1 SV=2 3 444 3.0E-150
sp|A1CAZ7|UBA4_ASPCL Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=uba4 PE=3 SV=1 7 444 6.0E-149
sp|B0Y0P7|UBA4_ASPFC Adenylyltransferase and sulfurtransferase uba4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=uba4 PE=3 SV=1 4 444 2.0E-148
sp|A7F582|UBA4_SCLS1 Adenylyltransferase and sulfurtransferase uba4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=uba4 PE=3 SV=1 2 444 2.0E-148
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A4RPM5|UBA4_MAGO7 Adenylyltransferase and sulfurtransferase uba4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=UBA4 PE=3 SV=1 3 446 1.0E-168
sp|O59954|UBA4_EMENI Adenylyltransferase and sulfurtransferase uba4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=uba4 PE=1 SV=2 3 444 3.0E-150
sp|A1CAZ7|UBA4_ASPCL Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=uba4 PE=3 SV=1 7 444 6.0E-149
sp|B0Y0P7|UBA4_ASPFC Adenylyltransferase and sulfurtransferase uba4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=uba4 PE=3 SV=1 4 444 2.0E-148
sp|A7F582|UBA4_SCLS1 Adenylyltransferase and sulfurtransferase uba4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=uba4 PE=3 SV=1 2 444 2.0E-148
sp|Q4WV19|UBA4_ASPFU Adenylyltransferase and sulfurtransferase uba4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=uba4 PE=3 SV=1 4 444 1.0E-147
sp|A2R3H4|UBA4_ASPNC Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=uba4 PE=3 SV=1 7 444 2.0E-147
sp|A1DED8|UBA4_NEOFI Adenylyltransferase and sulfurtransferase uba4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=uba4 PE=3 SV=1 7 444 1.0E-137
sp|Q0CFD4|UBA4_ASPTN Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=uba4 PE=3 SV=1 7 444 9.0E-137
sp|Q2TWN3|UBA4_ASPOR Adenylyltransferase and sulfurtransferase uba4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=uba4 PE=3 SV=1 38 444 5.0E-132
sp|Q9VLJ8|MOCS3_DROME Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila melanogaster GN=CG13090 PE=1 SV=1 3 445 1.0E-116
sp|A5DMB6|UBA4_PICGU Adenylyltransferase and sulfurtransferase UBA4 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=UBA4 PE=3 SV=1 6 445 1.0E-116
sp|B0W377|MOCS3_CULQU Adenylyltransferase and sulfurtransferase MOCS3 OS=Culex quinquefasciatus GN=CPIJ001621 PE=3 SV=1 10 445 2.0E-116
sp|B4HYP0|MOCS3_DROSE Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila sechellia GN=GM17034 PE=3 SV=1 7 445 3.0E-116
sp|B4JBC4|MOCS3_DROGR Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila grimshawi GN=GH10959 PE=3 SV=1 3 445 5.0E-114
sp|Q7PY41|MOCS3_ANOGA Adenylyltransferase and sulfurtransferase MOCS3 OS=Anopheles gambiae GN=AGAP001737 PE=3 SV=4 7 445 1.0E-112
sp|Q17CA7|MOCS3_AEDAE Adenylyltransferase and sulfurtransferase MOCS3 OS=Aedes aegypti GN=AAEL004607 PE=3 SV=1 13 445 3.0E-112
sp|B4N7R4|MOCS3_DROWI Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila willistoni GN=GK18675 PE=3 SV=1 2 445 3.0E-111
sp|B4GKQ3|MOCS3_DROPE Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila persimilis GN=GL26133 PE=3 SV=1 3 445 3.0E-111
sp|B4NXF7|MOCS3_DROYA Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila yakuba GN=GE18783 PE=3 SV=1 3 445 2.0E-110
sp|B5DS72|MOC31_DROPS Adenylyltransferase and sulfurtransferase MOCS3-1 OS=Drosophila pseudoobscura pseudoobscura GN=GA24966 PE=3 SV=1 3 445 3.0E-110
sp|B3MLX7|MOCS3_DROAN Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila ananassae GN=GF15533 PE=3 SV=1 3 445 4.0E-110
sp|Q29PG5|MOC32_DROPS Adenylyltransferase and sulfurtransferase MOCS3-2 OS=Drosophila pseudoobscura pseudoobscura GN=GA12041 PE=3 SV=1 3 445 1.0E-109
sp|A3LQF9|UBA4_PICST Adenylyltransferase and sulfurtransferase UBA4 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=UBA4 PE=3 SV=2 6 444 1.0E-105
sp|Q59WH7|UBA4_CANAL Adenylyltransferase and sulfurtransferase UBA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=UBA4 PE=3 SV=1 6 444 6.0E-105
sp|Q58E95|MOCS3_XENLA Adenylyltransferase and sulfurtransferase MOCS3 OS=Xenopus laevis GN=mocs3 PE=2 SV=1 39 444 1.0E-104
sp|B4LRB9|MOCS3_DROVI Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila virilis GN=GJ21670 PE=3 SV=1 3 445 2.0E-104
sp|A5DSR2|UBA4_LODEL Adenylyltransferase and sulfurtransferase UBA4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=UBA4 PE=3 SV=1 36 444 5.0E-104
sp|P38820|UBA4_YEAST Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBA4 PE=1 SV=1 10 444 1.0E-102
sp|B5VK45|UBA4_YEAS6 Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=UBA4 PE=3 SV=1 10 444 1.0E-102
sp|B3LSM6|UBA4_YEAS1 Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=UBA4 PE=3 SV=1 10 444 1.0E-102
sp|A6ZT19|UBA4_YEAS7 Adenylyltransferase and sulfurtransferase UBA4 OS=Saccharomyces cerevisiae (strain YJM789) GN=UBA4 PE=3 SV=1 10 444 2.0E-102
sp|Q6CMC2|UBA4_KLULA Adenylyltransferase and sulfurtransferase UBA4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=UBA4 PE=3 SV=1 7 444 2.0E-102
sp|B4KI53|MOCS3_DROMO Adenylyltransferase and sulfurtransferase MOCS3 OS=Drosophila mojavensis GN=GI10453 PE=3 SV=1 39 445 2.0E-101
sp|Q6BHZ2|UBA4_DEBHA Adenylyltransferase and sulfurtransferase UBA4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=UBA4 PE=3 SV=1 7 444 2.0E-101
sp|A1A4L8|MOCS3_BOVIN Adenylyltransferase and sulfurtransferase MOCS3 OS=Bos taurus GN=MOCS3 PE=2 SV=2 7 444 4.0E-100
sp|Q09810|UBA4_SCHPO Adenylyltransferase and sulfurtransferase uba4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uba4 PE=3 SV=1 32 445 2.0E-99
sp|Q6CBK1|UBA4_YARLI Adenylyltransferase and sulfurtransferase UBA4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=UBA4 PE=3 SV=1 38 445 6.0E-99
sp|Q756K6|UBA4_ASHGO Adenylyltransferase and sulfurtransferase UBA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=UBA4 PE=3 SV=1 7 444 4.0E-96
sp|Q9ZNW0|MOCS3_ARATH Adenylyltransferase and sulfurtransferase MOCS3 OS=Arabidopsis thaliana GN=MOCS3 PE=2 SV=1 3 444 7.0E-96
sp|A7THV5|UBA4_VANPO Adenylyltransferase and sulfurtransferase UBA4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=UBA4 PE=3 SV=1 10 444 9.0E-96
sp|Q8AWD2|MOCS3_DANRE Adenylyltransferase and sulfurtransferase MOCS3 OS=Danio rerio GN=mocs3 PE=2 SV=1 2 444 3.0E-93
sp|O95396|MOCS3_HUMAN Adenylyltransferase and sulfurtransferase MOCS3 OS=Homo sapiens GN=MOCS3 PE=1 SV=1 7 444 6.0E-92
sp|Q55FS0|UBA4_DICDI Adenylyltransferase and sulfurtransferase MOCS3 OS=Dictyostelium discoideum GN=mocs3 PE=3 SV=1 36 445 3.0E-91
sp|A5GFZ6|MOCS3_PIG Adenylyltransferase and sulfurtransferase MOCS3 OS=Sus scrofa GN=MOCS3 PE=3 SV=1 7 444 4.0E-91
sp|Q6FR35|UBA4_CANGA Adenylyltransferase and sulfurtransferase UBA4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=UBA4 PE=3 SV=1 7 444 2.0E-90
sp|B4FAT0|MOC32_MAIZE Adenylyltransferase and sulfurtransferase MOCS3-2 OS=Zea mays GN=MOCS3-2 PE=2 SV=1 34 444 1.0E-86
sp|A8WRE3|MOCS3_CAEBR Adenylyltransferase and sulfurtransferase MOCS3 OS=Caenorhabditis briggsae GN=uba-4 PE=3 SV=3 39 445 3.0E-86
sp|A2BDX3|MOCS3_MOUSE Adenylyltransferase and sulfurtransferase MOCS3 OS=Mus musculus GN=Mocs3 PE=1 SV=1 7 444 1.0E-85
sp|B6TNK6|MOC31_MAIZE Adenylyltransferase and sulfurtransferase MOCS3-1 OS=Zea mays GN=MOCS3-1 PE=2 SV=1 34 444 5.0E-85
sp|O44510|MOCS3_CAEEL Adenylyltransferase and sulfurtransferase MOCS3 OS=Caenorhabditis elegans GN=moc-3 PE=3 SV=2 39 445 1.0E-81
sp|A3ACF3|MOCS3_ORYSJ Adenylyltransferase and sulfurtransferase MOCS3 OS=Oryza sativa subsp. japonica GN=MOCS3 PE=3 SV=1 44 443 3.0E-70
sp|P9WMN7|MOEZ_MYCTU Probable adenylyltransferase/sulfurtransferase MoeZ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=moeZ PE=1 SV=1 35 443 4.0E-52
sp|P9WMN6|MOEZ_MYCTO Probable adenylyltransferase/sulfurtransferase MoeZ OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=moeZ PE=3 SV=1 35 443 4.0E-52
sp|P12282|MOEB_ECOLI Molybdopterin-synthase adenylyltransferase OS=Escherichia coli (strain K12) GN=moeB PE=1 SV=1 39 254 2.0E-48
sp|P45211|MOEB_HAEIN Molybdopterin-synthase adenylyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=moeB PE=3 SV=1 39 249 4.0E-45
sp|P30138|THIF_ECOLI Sulfur carrier protein ThiS adenylyltransferase OS=Escherichia coli (strain K12) GN=thiF PE=1 SV=2 39 251 3.0E-44
sp|P51335|MOEB_PORPU Probable molybdopterin-synthase adenylyltransferase OS=Porphyra purpurea GN=moeB PE=3 SV=1 43 439 5.0E-44
sp|Q56067|MOEB_SALTY Molybdopterin-synthase adenylyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=moeB PE=3 SV=2 39 254 1.0E-39
sp|Q6B908|MOEB_GRATL Probable molybdopterin-synthase adenylyltransferase OS=Gracilaria tenuistipitata var. liui GN=moeB PE=3 SV=1 33 372 4.0E-39
sp|D4GSF3|UBAA_HALVD SAMP-activating enzyme E1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=ubaA PE=1 SV=1 39 320 8.0E-39
sp|Q1XDF1|MOEB_PYRYE Probable molybdopterin-synthase adenylyltransferase OS=Pyropia yezoensis GN=moeB PE=3 SV=1 31 439 1.0E-37
sp|P46048|HESA2_ANAVT Protein HesA, vegetative OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hesA2 PE=2 SV=1 39 251 2.0E-33
sp|P46049|HESA1_ANAVT Protein HesA, heterocyst OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=hesA1 PE=2 SV=2 39 297 4.0E-32
sp|P46037|HESA_LEPBY Protein HesA OS=Leptolyngbya boryana GN=hesA PE=3 SV=1 39 313 3.0E-30
sp|P18500|HESA_NOSS1 Protein HesA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hesA PE=3 SV=2 51 291 3.0E-27
sp|O31619|THIF_BACSU Sulfur carrier protein ThiS adenylyltransferase OS=Bacillus subtilis (strain 168) GN=thiF PE=3 SV=1 46 319 2.0E-21
sp|O31702|MOEB_BACSU Molybdopterin-synthase adenylyltransferase OS=Bacillus subtilis (strain 168) GN=moeB PE=3 SV=1 45 251 1.0E-20
sp|Q9SJT1|SAE2_ARATH SUMO-activating enzyme subunit 2 OS=Arabidopsis thaliana GN=SAE2 PE=1 SV=1 59 225 7.0E-18
sp|Q9Z1F9|SAE2_MOUSE SUMO-activating enzyme subunit 2 OS=Mus musculus GN=Uba2 PE=1 SV=1 69 225 3.0E-17
sp|O42939|UBA2_SCHPO Ubiquitin-activating enzyme E1-like OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uba2 PE=1 SV=1 54 218 6.0E-17
sp|Q9NAN1|SAE2_CAEEL SUMO-activating enzyme subunit uba-2 OS=Caenorhabditis elegans GN=uba-2 PE=3 SV=3 59 225 6.0E-17
sp|Q9UBT2|SAE2_HUMAN SUMO-activating enzyme subunit 2 OS=Homo sapiens GN=UBA2 PE=1 SV=2 69 225 4.0E-16
sp|Q7SXG4|SAE2_DANRE SUMO-activating enzyme subunit 2 OS=Danio rerio GN=uba2 PE=1 SV=2 64 225 8.0E-16
sp|Q54C02|UBA5_DICDI Ubiquitin-like modifier-activating enzyme 5 OS=Dictyostelium discoideum GN=uba5 PE=3 SV=1 47 214 1.0E-15
sp|Q28GH3|SAE2_XENTR SUMO-activating enzyme subunit 2 OS=Xenopus tropicalis GN=uba2 PE=2 SV=1 64 225 2.0E-15
sp|Q7ZY60|SAE2B_XENLA SUMO-activating enzyme subunit 2-B OS=Xenopus laevis GN=uba2-b PE=2 SV=2 69 225 3.0E-15
sp|Q642Q1|SAE2A_XENLA SUMO-activating enzyme subunit 2-A OS=Xenopus laevis GN=uba2-a PE=2 SV=1 69 225 8.0E-15
sp|A3KMV5|UBA1_BOVIN Ubiquitin-like modifier-activating enzyme 1 OS=Bos taurus GN=UBA1 PE=2 SV=1 45 199 4.0E-14
sp|Q6K6K7|UBA5_ORYSJ Ubiquitin-like modifier-activating enzyme 5 OS=Oryza sativa subsp. japonica GN=Os02g0506500 PE=2 SV=1 6 244 5.0E-14
sp|Q5U300|UBA1_RAT Ubiquitin-like modifier-activating enzyme 1 OS=Rattus norvegicus GN=Uba1 PE=1 SV=1 45 199 9.0E-14
sp|P22314|UBA1_HUMAN Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens GN=UBA1 PE=1 SV=3 45 199 1.0E-13
sp|P31254|UBA1Y_MOUSE Ubiquitin-like modifier-activating enzyme 1 Y OS=Mus musculus GN=Uba1y PE=1 SV=2 45 199 2.0E-13
sp|Q29504|UBA1_RABIT Ubiquitin-like modifier-activating enzyme 1 OS=Oryctolagus cuniculus GN=UBA1 PE=1 SV=1 45 199 2.0E-13
sp|Q02053|UBA1_MOUSE Ubiquitin-like modifier-activating enzyme 1 OS=Mus musculus GN=Uba1 PE=1 SV=1 45 199 5.0E-13
sp|O23034|UBA5_ARATH Ubiquitin-like modifier-activating enzyme 5 OS=Arabidopsis thaliana GN=At1g05350 PE=3 SV=2 47 244 5.0E-13
sp|P20973|UBE11_WHEAT Ubiquitin-activating enzyme E1 1 OS=Triticum aestivum GN=UBA1 PE=1 SV=1 46 187 6.0E-13
sp|O94609|UBA1_SCHPO Ubiquitin-activating enzyme E1 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr3 PE=1 SV=1 46 199 2.0E-12
sp|Q54L40|SAE2_DICDI SUMO-activating enzyme subunit 2 OS=Dictyostelium discoideum GN=uba2 PE=3 SV=1 45 211 2.0E-12
sp|P92974|UBE12_ARATH Ubiquitin-activating enzyme E1 2 OS=Arabidopsis thaliana GN=UBA2 PE=1 SV=1 35 187 2.0E-12
sp|P31251|UBE12_WHEAT Ubiquitin-activating enzyme E1 2 OS=Triticum aestivum GN=UBA2 PE=2 SV=1 46 187 3.0E-12
sp|Q55C16|UBA1_DICDI Ubiquitin-like modifier-activating enzyme 1 OS=Dictyostelium discoideum GN=uba1 PE=3 SV=1 39 199 8.0E-12
sp|Q46927|TCDA_ECOLI tRNA threonylcarbamoyladenosine dehydratase OS=Escherichia coli (strain K12) GN=tcdA PE=1 SV=1 39 186 9.0E-12
sp|P31252|UBE13_WHEAT Ubiquitin-activating enzyme E1 3 OS=Triticum aestivum GN=UBA3 PE=1 SV=1 35 187 1.0E-11
sp|P22515|UBA1_YEAST Ubiquitin-activating enzyme E1 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBA1 PE=1 SV=2 46 225 2.0E-11
sp|Q8VE47|UBA5_MOUSE Ubiquitin-like modifier-activating enzyme 5 OS=Mus musculus GN=Uba5 PE=1 SV=2 2 214 2.0E-11
sp|P52495|UBA1_CANAW Ubiquitin-activating enzyme E1 1 OS=Candida albicans (strain WO-1) GN=UBA1 PE=3 SV=2 46 199 5.0E-11
sp|Q8JGT5|SAE1_XENLA SUMO-activating enzyme subunit 1 OS=Xenopus laevis GN=sae1 PE=2 SV=1 39 160 1.0E-10
sp|Q28DS0|SAE1_XENTR SUMO-activating enzyme subunit 1 OS=Xenopus tropicalis GN=sae1 PE=2 SV=1 39 160 1.0E-10
sp|O65041|UBA3_ARATH NEDD8-activating enzyme E1 catalytic subunit OS=Arabidopsis thaliana GN=ECR1 PE=1 SV=2 52 218 1.0E-10
sp|P93028|UBE11_ARATH Ubiquitin-activating enzyme E1 1 OS=Arabidopsis thaliana GN=UBA1 PE=1 SV=1 35 187 4.0E-10
sp|P52488|UBA2_YEAST Ubiquitin-activating enzyme E1-like OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBA2 PE=1 SV=1 52 225 5.0E-10
sp|P41226|UBA7_HUMAN Ubiquitin-like modifier-activating enzyme 7 OS=Homo sapiens GN=UBA7 PE=1 SV=2 46 199 1.0E-09
sp|Q9V6U8|UBA3_DROME Nedd8-activating enzyme E1 catalytic subunit OS=Drosophila melanogaster GN=Uba3 PE=1 SV=1 66 218 2.0E-09
sp|C3YZ51|UBA5_BRAFL Ubiquitin-like modifier-activating enzyme 5 OS=Branchiostoma floridae GN=BRAFLDRAFT_113714 PE=3 SV=1 47 241 2.0E-09
sp|A7MAZ3|UBA5_BOVIN Ubiquitin-like modifier-activating enzyme 5 OS=Bos taurus GN=UBA5 PE=2 SV=1 6 214 3.0E-09
sp|Q5M7A4|UBA5_RAT Ubiquitin-like modifier-activating enzyme 5 OS=Rattus norvegicus GN=Uba5 PE=1 SV=1 6 214 3.0E-09
sp|Q57097|TCDA_HAEIN tRNA threonylcarbamoyladenosine dehydratase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tcdA PE=3 SV=1 63 170 3.0E-09
sp|Q6IVA4|UBA5_CHICK Ubiquitin-like modifier-activating enzyme 5 OS=Gallus gallus GN=UBA5 PE=2 SV=1 47 214 5.0E-09
sp|Q5R8X4|UBA5_PONAB Ubiquitin-like modifier-activating enzyme 5 OS=Pongo abelii GN=UBA5 PE=2 SV=1 6 214 8.0E-09
sp|Q99MI7|UBA3_RAT NEDD8-activating enzyme E1 catalytic subunit OS=Rattus norvegicus GN=Uba3 PE=1 SV=1 61 218 8.0E-09
sp|Q8C878|UBA3_MOUSE NEDD8-activating enzyme E1 catalytic subunit OS=Mus musculus GN=Uba3 PE=1 SV=2 61 218 8.0E-09
sp|Q9GZZ9|UBA5_HUMAN Ubiquitin-like modifier-activating enzyme 5 OS=Homo sapiens GN=UBA5 PE=1 SV=1 6 214 9.0E-09
sp|Q3KQ23|UBA5_XENLA Ubiquitin-like modifier-activating enzyme 5 OS=Xenopus laevis GN=uba5 PE=2 SV=1 81 214 1.0E-08
sp|Q8TBC4|UBA3_HUMAN NEDD8-activating enzyme E1 catalytic subunit OS=Homo sapiens GN=UBA3 PE=1 SV=2 61 218 1.0E-08
sp|Q5R4A0|UBA3_PONAB NEDD8-activating enzyme E1 catalytic subunit OS=Pongo abelii GN=UBA3 PE=2 SV=2 61 218 1.0E-08
sp|A2VE14|SAE1_BOVIN SUMO-activating enzyme subunit 1 OS=Bos taurus GN=SAE1 PE=2 SV=1 39 160 1.0E-08
sp|Q19360|UBA3_CAEEL NEDD8-activating enzyme E1 catalytic subunit OS=Caenorhabditis elegans GN=uba-3 PE=2 SV=2 53 180 1.0E-08
sp|Q54QG9|UBA3_DICDI NEDD8-activating enzyme E1 catalytic subunit OS=Dictyostelium discoideum GN=uba3 PE=1 SV=1 69 225 2.0E-08
sp|Q6AXQ0|SAE1_RAT SUMO-activating enzyme subunit 1 OS=Rattus norvegicus GN=Sae1 PE=2 SV=1 46 160 3.0E-08
sp|Q5NVN7|SAE1_PONAB SUMO-activating enzyme subunit 1 OS=Pongo abelii GN=SAE1 PE=2 SV=2 39 160 3.0E-08
sp|Q9UBE0|SAE1_HUMAN SUMO-activating enzyme subunit 1 OS=Homo sapiens GN=SAE1 PE=1 SV=1 39 160 3.0E-08
sp|Q09765|UBA3_SCHPO NEDD8-activating enzyme E1 catalytic subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=uba3 PE=1 SV=1 67 211 6.0E-08
sp|Q6GLG7|UBA5_XENTR Ubiquitin-like modifier-activating enzyme 5 OS=Xenopus tropicalis GN=uba5 PE=2 SV=1 6 214 8.0E-08
sp|B9VJ80|UBA5_BOMMO Ubiquitin-like modifier-activating enzyme 5 OS=Bombyx mori PE=2 SV=1 1 214 9.0E-08
sp|B4M357|UBA5_DROVI Ubiquitin-like modifier-activating enzyme 5 OS=Drosophila virilis GN=GJ19153 PE=3 SV=1 7 214 2.0E-07
sp|B4PYA4|UBA5_DROYA Ubiquitin-like modifier-activating enzyme 5 OS=Drosophila yakuba GN=GE15940 PE=3 SV=1 7 214 2.0E-07
sp|A8XEQ8|UBA5_CAEBR Ubiquitin-like modifier-activating enzyme 5 OS=Caenorhabditis briggsae GN=uba-5 PE=3 SV=2 85 214 2.0E-07
sp|Q29HT0|UBA5_DROPS Ubiquitin-like modifier-activating enzyme 5 OS=Drosophila pseudoobscura pseudoobscura GN=GA14526 PE=3 SV=1 47 214 3.0E-07
sp|Q7ZVX6|UBA3_DANRE NEDD8-activating enzyme E1 catalytic subunit OS=Danio rerio GN=uba3 PE=2 SV=1 61 218 4.0E-07
sp|P91430|UBA5_CAEEL Ubiquitin-like modifier-activating enzyme 5 OS=Caenorhabditis elegans GN=uba-5 PE=1 SV=1 85 214 4.0E-07
sp|Q9R1T2|SAE1_MOUSE SUMO-activating enzyme subunit 1 OS=Mus musculus GN=Sae1 PE=1 SV=1 46 160 6.0E-07
sp|B4L1K2|UBA5_DROMO Ubiquitin-like modifier-activating enzyme 5 OS=Drosophila mojavensis GN=GI14749 PE=3 SV=1 11 214 8.0E-07
sp|B4JIY0|UBA5_DROGR Ubiquitin-like modifier-activating enzyme 5 OS=Drosophila grimshawi GN=GH12371 PE=3 SV=1 47 214 9.0E-07
sp|Q93WI0|STR12_ARATH Rhodanese-like/PpiC domain-containing protein 12, chloroplastic OS=Arabidopsis thaliana GN=At5g19370 PE=1 SV=1 277 444 1.0E-06
sp|B0WQV1|UBA5_CULQU Ubiquitin-like modifier-activating enzyme 5 OS=Culex quinquefasciatus GN=CPIJ009416 PE=3 SV=1 1 214 1.0E-06
sp|Q8C7R4|UBA6_MOUSE Ubiquitin-like modifier-activating enzyme 6 OS=Mus musculus GN=Uba6 PE=1 SV=1 62 225 1.0E-06
sp|B4GYC7|UBA5_DROPE Ubiquitin-like modifier-activating enzyme 5 OS=Drosophila persimilis GN=GL19893 PE=3 SV=1 49 214 1.0E-06
sp|Q9VYY3|UBA5_DROME Ubiquitin-like modifier-activating enzyme 5 OS=Drosophila melanogaster GN=CG1749 PE=2 SV=1 7 214 1.0E-06
sp|B4IK21|UBA5_DROSE Ubiquitin-like modifier-activating enzyme 5 OS=Drosophila sechellia GN=GM13085 PE=3 SV=1 7 214 1.0E-06
sp|P31252|UBE13_WHEAT Ubiquitin-activating enzyme E1 3 OS=Triticum aestivum GN=UBA3 PE=1 SV=1 47 180 2.0E-06
sp|B4R345|UBA5_DROSI Ubiquitin-like modifier-activating enzyme 5 OS=Drosophila simulans GN=GD17028 PE=3 SV=2 7 214 2.0E-06
sp|Q17DT0|UBA5_AEDAE Ubiquitin-like modifier-activating enzyme 5 OS=Aedes aegypti GN=AAEL004076 PE=3 SV=1 47 214 3.0E-06
sp|Q6IQS6|SAE1_DANRE SUMO-activating enzyme subunit 1 OS=Danio rerio GN=sae1 PE=2 SV=1 36 143 9.0E-06
sp|Q99344|UBA3_YEAST NEDD8-activating enzyme E1 catalytic subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBA3 PE=1 SV=1 67 160 1.0E-05
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 69 91 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|43
MDKAGRLRQEIAQREAELADLRTQLSECGSDCAAPDRPLTEAEIQRYGRQMIVPGFGLQAQRRLGRASVLIVGAG
GLGCPAAAYLAGAGVGVLGLVDADTVEVSNLHRQMAHSTERVGMAKVESAIVYLRQLNPTVSYRAHQEHLSPRNV
RAIVSQYDMVLDCTDHPAARYLVSDACVLLDKPLVSASAFQLSGQLTVLNSPPGGGPCYRCLFPRPPPPETVVGC
GEGGILGPVVGTMGVLQALEAVTLIASGGLDANSSPQQQQQPRLLLLSATAQGRPEFRSVRLRGRRDDCFACSAE
GGLTLQHLETSMDYVAFCGVVGPVSLLEPDERVSVDEYLRRCAAQPDHVLLDVRGKEHFSLGSIPGAINLPIHHF
SRGQDVTELLEPHVRPDVPIYVVCRVGNDSQAVARKLKDLGLHQGGDRFVGDIVGGVKAWRDTIDPTMPFI
Coding >Ophio5|43
ATGGACAAGGCCGGCCGCCTCCGCCAGGAAATTGCCCAGCGGGAAGCCGAACTCGCCGACCTCCGGACACAGCTC
TCCGAATGCGGCTCCGATTGCGCGGCTCCGGACCGGCCGCTAACCGAGGCCGAAATCCAACGTTACGGCCGGCAG
ATGATTGTCCCGGGCTTCGGCCTCCAAGCGCAGCGGCGGCTCGGGCGGGCCAGCGTCCTCATCGTCGGTGCCGGC
GGACTCGGATGTCCGGCGGCTGCCTATCTGGCGGGCGCCGGCGTGGGCGTGTTGGGCCTCGTGGATGCAGACACG
GTCGAGGTGTCGAATCTACATCGTCAGATGGCGCATTCGACGGAAAGGGTGGGAATGGCAAAGGTGGAGAGCGCC
ATCGTTTATCTGCGGCAACTTAACCCAACTGTCTCGTATCGCGCCCACCAAGAGCACCTCTCGCCGCGCAATGTC
CGGGCCATCGTCTCGCAGTACGACATGGTCCTCGACTGCACTGACCACCCAGCCGCGCGCTATCTCGTCTCCGAC
GCCTGCGTCCTGCTCGACAAGCCGTTGGTCTCGGCCTCGGCCTTTCAGCTATCGGGACAGCTCACGGTGCTCAAC
AGCCCGCCTGGCGGCGGCCCCTGCTACCGCTGCCTATTCCCGCGCCCGCCGCCGCCTGAGACGGTCGTCGGCTGC
GGTGAGGGCGGCATCCTGGGACCCGTCGTAGGCACCATGGGTGTGCTACAGGCTCTCGAGGCTGTCACGCTCATC
GCCAGCGGGGGCTTGGATGCCAATTCGTCGCCGCAGCAGCAGCAGCAGCCTCGGTTGCTACTCCTCAGCGCCACC
GCTCAGGGACGGCCCGAGTTTCGATCGGTGCGCCTCCGAGGCAGACGAGACGACTGCTTTGCCTGCTCTGCTGAG
GGCGGGCTGACGCTGCAGCATCTCGAGACGTCGATGGATTACGTAGCCTTCTGCGGCGTTGTCGGGCCTGTCTCG
CTCCTTGAGCCTGATGAGCGCGTCTCTGTCGACGAATATCTGCGCAGGTGCGCCGCTCAGCCGGATCATGTCCTG
CTCGACGTCCGAGGAAAGGAGCACTTTAGTCTCGGCAGCATCCCAGGCGCCATCAACCTGCCTATCCACCACTTC
AGCCGGGGCCAAGATGTGACTGAGCTCCTCGAGCCGCACGTCCGACCCGACGTTCCCATCTACGTCGTTTGTCGC
GTCGGCAACGACTCTCAAGCCGTGGCGCGGAAACTCAAGGACCTTGGACTGCACCAAGGAGGTGACCGCTTCGTC
GGCGACATTGTAGGAGGAGTCAAGGCGTGGAGGGACACCATCGATCCCACCATGCCTTTCATT
Transcript >Ophio5|43
ATGGACAAGGCCGGCCGCCTCCGCCAGGAAATTGCCCAGCGGGAAGCCGAACTCGCCGACCTCCGGACACAGCTC
TCCGAATGCGGCTCCGATTGCGCGGCTCCGGACCGGCCGCTAACCGAGGCCGAAATCCAACGTTACGGCCGGCAG
ATGATTGTCCCGGGCTTCGGCCTCCAAGCGCAGCGGCGGCTCGGGCGGGCCAGCGTCCTCATCGTCGGTGCCGGC
GGACTCGGATGTCCGGCGGCTGCCTATCTGGCGGGCGCCGGCGTGGGCGTGTTGGGCCTCGTGGATGCAGACACG
GTCGAGGTGTCGAATCTACATCGTCAGATGGCGCATTCGACGGAAAGGGTGGGAATGGCAAAGGTGGAGAGCGCC
ATCGTTTATCTGCGGCAACTTAACCCAACTGTCTCGTATCGCGCCCACCAAGAGCACCTCTCGCCGCGCAATGTC
CGGGCCATCGTCTCGCAGTACGACATGGTCCTCGACTGCACTGACCACCCAGCCGCGCGCTATCTCGTCTCCGAC
GCCTGCGTCCTGCTCGACAAGCCGTTGGTCTCGGCCTCGGCCTTTCAGCTATCGGGACAGCTCACGGTGCTCAAC
AGCCCGCCTGGCGGCGGCCCCTGCTACCGCTGCCTATTCCCGCGCCCGCCGCCGCCTGAGACGGTCGTCGGCTGC
GGTGAGGGCGGCATCCTGGGACCCGTCGTAGGCACCATGGGTGTGCTACAGGCTCTCGAGGCTGTCACGCTCATC
GCCAGCGGGGGCTTGGATGCCAATTCGTCGCCGCAGCAGCAGCAGCAGCCTCGGTTGCTACTCCTCAGCGCCACC
GCTCAGGGACGGCCCGAGTTTCGATCGGTGCGCCTCCGAGGCAGACGAGACGACTGCTTTGCCTGCTCTGCTGAG
GGCGGGCTGACGCTGCAGCATCTCGAGACGTCGATGGATTACGTAGCCTTCTGCGGCGTTGTCGGGCCTGTCTCG
CTCCTTGAGCCTGATGAGCGCGTCTCTGTCGACGAATATCTGCGCAGGTGCGCCGCTCAGCCGGATCATGTCCTG
CTCGACGTCCGAGGAAAGGAGCACTTTAGTCTCGGCAGCATCCCAGGCGCCATCAACCTGCCTATCCACCACTTC
AGCCGGGGCCAAGATGTGACTGAGCTCCTCGAGCCGCACGTCCGACCCGACGTTCCCATCTACGTCGTTTGTCGC
GTCGGCAACGACTCTCAAGCCGTGGCGCGGAAACTCAAGGACCTTGGACTGCACCAAGGAGGTGACCGCTTCGTC
GGCGACATTGTAGGAGGAGTCAAGGCGTGGAGGGACACCATCGATCCCACCATGCCTTTCATTTAG
Gene >Ophio5|43
ATGGACAAGGCCGGCCGCCTCCGCCAGGAAATTGCCCAGCGGGAAGCCGAACTCGCCGACCTCCGGACACAGCTC
TCCGAATGCGGCTCCGATTGCGCGGCTCCGGACCGGCCGCTAACCGAGGCCGAAATCCAACGTTACGGCCGGCAG
ATGATTGTCCCGGGCTTCGGCCTCCAAGGTGAGCATCCACCCCAACTCCCGGCTTTTCCACGTTGGACACCAACT
GACAAGCAAGCGTGGCCAAGCGCAGCGGCGGCTCGGGCGGGCCAGCGTCCTCATCGTCGGTGCCGGCGGACTCGG
ATGTCCGGCGGCTGCCTATCTGGCGGGCGCCGGCGTGGGCGTGTTGGGCCTCGTGGATGCAGACACGGTCGAGGT
GTCGAATCTACATCGTCAGATGGCGCATTCGACGGAAAGGGTGGGAATGGCAAAGGTGGAGAGCGCCATCGTTTA
TCTGCGGCAGTAAGTTGTGGTTCCCGTCTTCCCCTGAAGCTGTATGCCGTGTTTCCTGGCTGATGCCGATGATGC
AGACTTAACCCAACTGTCTCGTATCGCGCCCACCAAGAGCACCTCTCGCCGCGCAATGTCCGGGCCATCGTCTCG
CAGTACGACATGGTCCTCGACTGCACTGACCACCCAGCCGCGCGCTATCTCGTCTCCGACGCCTGCGTCCTGCTC
GACAAGCCGTTGGTCTCGGCCTCGGCCTTTCAGCTATCGGGACAGCTCACGGTGCTCAACAGCCCGCCTGGCGGC
GGCCCCTGCTACCGCTGCCTATTCCCGCGCCCGCCGCCGCCTGAGACGGTCGTCGGCTGCGGTGAGGGCGGCATC
CTGGGACCCGTCGTAGGCACCATGGGTGTGCTACAGGCTCTCGAGGCTGTCACGCTCATCGCCAGCGGGGGCTTG
GATGCCAATTCGTCGCCGCAGCAGCAGCAGCAGCCTCGGTTGCTACTCCTCAGCGCCACCGCTCAGGGACGGCCC
GAGTTTCGATCGGTGCGCCTCCGAGGCAGACGAGACGACTGCTTTGCCTGCTCTGCTGAGGGCGGGCTGACGCTG
CAGCATCTCGAGACGTCGATGGATTACGTAGCCTTCTGCGGCGTTGTCGGGCCTGTCTCGCTCCTTGAGCCTGAT
GAGCGCGTCTCTGTCGACGAATATCTGCGCAGGTGCGCCGCTCAGCCGGATCATGTCCTGCTCGACGTCCGAGGA
AAGGAGCACTTTAGTCTCGGCAGCATCCCAGGCGCCATCAACCTGCCTATCCACCACTTCAGCCGGGGCCAAGAT
GTGACTGAGCTCCTCGAGCCGCACGTCCGACCCGACGTTCCCATCTACGTCGTTTGTCGCGTCGGCAACGACTCT
CAAGCCGTGGCGCGGAAACTCAAGGACCTTGGACTGCACCAAGGAGGTGACCGCTTCGTCGGCGACATTGTAGGA
GGAGTCAAGGCGTGGAGGGACACCATCGATCCCACCATGCCTTTCATTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail