Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4284
Gene name
Locationscaffold_339:769..2656
Strand-
Gene length (bp)1887
Transcript length (bp)1428
Coding sequence length (bp)1425
Protein length (aa) 475

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 9.1E-24 199 371
PF13649 Methyltransf_25 Methyltransferase domain 7.8E-14 222 310
PF08241 Methyltransf_11 Methyltransferase domain 3.5E-13 223 312
PF08242 Methyltransf_12 Methyltransferase domain 9.9E-10 223 312

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 220 323 1.0E-09
sp|Q944H0|PEAM2_ARATH Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana GN=NMT2 PE=2 SV=2 220 327 3.0E-09
sp|Q9C6B9|PEAM3_ARATH Phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3 PE=2 SV=2 220 326 7.0E-09
sp|E3H9W1|BIOC1_ILYPC Malonyl-[acyl-carrier protein] O-methyltransferase 1 OS=Ilyobacter polytropus (strain DSM 2926 / CuHBu1) GN=bioC1 PE=3 SV=1 199 312 2.0E-08
sp|E3HCT1|BIOC2_ILYPC Malonyl-[acyl-carrier protein] O-methyltransferase 2 OS=Ilyobacter polytropus (strain DSM 2926 / CuHBu1) GN=bioC2 PE=3 SV=1 199 312 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FR44|PEAM1_ARATH Phosphoethanolamine N-methyltransferase 1 OS=Arabidopsis thaliana GN=NMT1 PE=1 SV=1 220 323 1.0E-09
sp|Q944H0|PEAM2_ARATH Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana GN=NMT2 PE=2 SV=2 220 327 3.0E-09
sp|Q9C6B9|PEAM3_ARATH Phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3 PE=2 SV=2 220 326 7.0E-09
sp|E3H9W1|BIOC1_ILYPC Malonyl-[acyl-carrier protein] O-methyltransferase 1 OS=Ilyobacter polytropus (strain DSM 2926 / CuHBu1) GN=bioC1 PE=3 SV=1 199 312 2.0E-08
sp|E3HCT1|BIOC2_ILYPC Malonyl-[acyl-carrier protein] O-methyltransferase 2 OS=Ilyobacter polytropus (strain DSM 2926 / CuHBu1) GN=bioC2 PE=3 SV=1 199 312 1.0E-07
sp|Q9RX93|TAM_DEIRA Trans-aconitate 2-methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tam PE=3 SV=1 211 315 6.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6678 0.4211 0.0441 0.1054 0.2239 0.0285 0.2553 0.2422 0.2598 0.1119

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup116
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1824
Ophiocordyceps australis 1348a (Ghana) OphauG2|2470
Ophiocordyceps australis map64 (Brazil) OphauB2|3061
Ophiocordyceps australis map64 (Brazil) OphauB2|4472
Ophiocordyceps camponoti-floridani Ophcf2|00879
Ophiocordyceps camponoti-floridani Ophcf2|06995
Ophiocordyceps camponoti-rufipedis Ophun1|5295
Ophiocordyceps camponoti-rufipedis Ophun1|6510
Ophiocordyceps kimflemingae Ophio5|4284 (this protein)
Ophiocordyceps kimflemingae Ophio5|5055
Ophiocordyceps kimflemingae Ophio5|6669
Ophiocordyceps subramaniannii Hirsu2|3221
Ophiocordyceps subramaniannii Hirsu2|38
Ophiocordyceps subramaniannii Hirsu2|7756

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4284
MISSADERVRNAGNGQHGDVDVDEHRDPAETPEAFRHGQRQTAATAAVAAASSPPPPPPPPPPPSSSSPRHEDKP
HSMSGSCCVASSSSSSSRLASPLTHPNGTSIFPSLSTTEQQDIAREALSQAQDAIVADTFDEEMVRDESDAGYSS
DGFSSGSTSAESSVRDYLYENGRRYHRFREGSYNFPNDDVEQEREDMKHAMVRLLCSQKLLFAPIGEHPQQILDI
GTGTGIWAIEVGDQFPSAHVLGVDLSPIQPDWLPPNVRFLVDDVESTWLYPRNHFDYIHSRHTVMAVRDWRRLFR
QAYQHLKPGGWIEVQEIHHKPRSARPQGTVPQDHAVAQFWSRVNEGLTTLGVDLDRASGGFLAQAMRDEGLVNLT
ERVFHVPIGTWPKNKVLKTVGLYWRTILLDGLQAIALGPLTRGLRWNRDQVELFLMDVRRAYHDNAALMYMPLHI
VYAQKPEVSVFRCHVFSSPPAGSIS
Coding >Ophio5|4284
ATGATCTCGTCCGCCGACGAAAGGGTCAGAAATGCCGGCAACGGCCAGCATGGCGACGTCGACGTCGACGAGCAT
CGCGACCCGGCCGAGACACCCGAAGCTTTTCGGCACGGGCAGAGACAGACGGCGGCAACAGCAGCAGTAGCAGCA
GCGTCATCACCACCACCACCACCACCACCACCACCACCACCATCATCATCATCACCGCGACACGAGGACAAGCCT
CACAGCATGTCCGGCTCGTGCTGCGTGGCCTCATCTTCCTCATCATCATCGCGACTCGCGTCTCCGCTGACGCAC
CCAAACGGCACCTCGATATTCCCTTCGCTTTCGACGACGGAACAACAAGACATAGCTCGCGAGGCCTTATCTCAG
GCCCAAGACGCCATCGTCGCAGATACCTTTGACGAGGAAATGGTTCGCGACGAGTCTGACGCAGGTTATAGCAGC
GATGGCTTCAGCTCTGGCAGCACATCGGCCGAGTCTTCGGTCCGCGATTACCTGTACGAGAACGGGCGACGATAT
CATCGCTTTCGCGAGGGGAGCTACAACTTTCCCAACGACGACGTCGAGCAAGAGCGCGAGGATATGAAGCATGCC
ATGGTCAGACTGCTGTGTAGCCAGAAGTTGCTCTTCGCTCCCATTGGCGAGCATCCGCAGCAAATTCTCGACATC
GGAACCGGCACTGGGATATGGGCCATCGAGGTGGGAGACCAGTTTCCGAGCGCCCATGTGTTGGGTGTCGATCTG
TCGCCTATTCAGCCCGACTGGCTGCCTCCCAATGTGCGCTTCCTCGTCGACGACGTCGAGTCGACCTGGCTCTAT
CCACGGAACCATTTCGACTATATACACTCGCGACATACCGTCATGGCCGTCCGCGACTGGCGACGTCTGTTCCGT
CAAGCCTATCAACACCTCAAACCCGGCGGCTGGATCGAAGTCCAAGAGATACACCACAAGCCACGCAGCGCCCGA
CCGCAAGGCACCGTCCCCCAAGATCACGCCGTCGCCCAATTCTGGTCTCGCGTCAACGAGGGCCTCACCACGCTG
GGCGTCGACCTCGACCGCGCCAGCGGCGGCTTCCTGGCCCAAGCCATGCGCGACGAGGGCCTCGTCAACCTCACC
GAACGCGTCTTCCACGTCCCCATCGGCACCTGGCCCAAGAACAAGGTCCTCAAGACGGTAGGCCTCTACTGGCGA
ACTATCCTGCTCGACGGACTGCAGGCCATCGCTTTGGGACCCTTGACTCGTGGCTTGCGCTGGAATCGTGACCAG
GTCGAGCTTTTCCTTATGGATGTGAGGCGCGCCTATCATGATAATGCCGCCCTCATGTATATGCCGTTGCATATC
GTTTACGCTCAGAAACCCGAGGTTTCCGTTTTCCGTTGCCATGTTTTCTCCTCTCCCCCGGCCGGTTCCATCTCC
Transcript >Ophio5|4284
ATGATCTCGTCCGCCGACGAAAGGGTCAGAAATGCCGGCAACGGCCAGCATGGCGACGTCGACGTCGACGAGCAT
CGCGACCCGGCCGAGACACCCGAAGCTTTTCGGCACGGGCAGAGACAGACGGCGGCAACAGCAGCAGTAGCAGCA
GCGTCATCACCACCACCACCACCACCACCACCACCACCACCATCATCATCATCACCGCGACACGAGGACAAGCCT
CACAGCATGTCCGGCTCGTGCTGCGTGGCCTCATCTTCCTCATCATCATCGCGACTCGCGTCTCCGCTGACGCAC
CCAAACGGCACCTCGATATTCCCTTCGCTTTCGACGACGGAACAACAAGACATAGCTCGCGAGGCCTTATCTCAG
GCCCAAGACGCCATCGTCGCAGATACCTTTGACGAGGAAATGGTTCGCGACGAGTCTGACGCAGGTTATAGCAGC
GATGGCTTCAGCTCTGGCAGCACATCGGCCGAGTCTTCGGTCCGCGATTACCTGTACGAGAACGGGCGACGATAT
CATCGCTTTCGCGAGGGGAGCTACAACTTTCCCAACGACGACGTCGAGCAAGAGCGCGAGGATATGAAGCATGCC
ATGGTCAGACTGCTGTGTAGCCAGAAGTTGCTCTTCGCTCCCATTGGCGAGCATCCGCAGCAAATTCTCGACATC
GGAACCGGCACTGGGATATGGGCCATCGAGGTGGGAGACCAGTTTCCGAGCGCCCATGTGTTGGGTGTCGATCTG
TCGCCTATTCAGCCCGACTGGCTGCCTCCCAATGTGCGCTTCCTCGTCGACGACGTCGAGTCGACCTGGCTCTAT
CCACGGAACCATTTCGACTATATACACTCGCGACATACCGTCATGGCCGTCCGCGACTGGCGACGTCTGTTCCGT
CAAGCCTATCAACACCTCAAACCCGGCGGCTGGATCGAAGTCCAAGAGATACACCACAAGCCACGCAGCGCCCGA
CCGCAAGGCACCGTCCCCCAAGATCACGCCGTCGCCCAATTCTGGTCTCGCGTCAACGAGGGCCTCACCACGCTG
GGCGTCGACCTCGACCGCGCCAGCGGCGGCTTCCTGGCCCAAGCCATGCGCGACGAGGGCCTCGTCAACCTCACC
GAACGCGTCTTCCACGTCCCCATCGGCACCTGGCCCAAGAACAAGGTCCTCAAGACGGTAGGCCTCTACTGGCGA
ACTATCCTGCTCGACGGACTGCAGGCCATCGCTTTGGGACCCTTGACTCGTGGCTTGCGCTGGAATCGTGACCAG
GTCGAGCTTTTCCTTATGGATGTGAGGCGCGCCTATCATGATAATGCCGCCCTCATGTATATGCCGTTGCATATC
GTTTACGCTCAGAAACCCGAGGTTTCCGTTTTCCGTTGCCATGTTTTCTCCTCTCCCCCGGCCGGTTCCATCTCC
TAG
Gene >Ophio5|4284
ATGATCTCGTCCGCCGACGAAAGGGTCAGAAATGCCGGCAACGGCCAGCATGGCGACGTCGACGTCGACGAGCAT
CGCGACCCGGCCGAGACACCCGAAGCTTTTCGGCACGGGCAGAGACAGACGGCGGCAACAGCAGCAGTAGCAGCA
GCGTCATCACCACCACCACCACCACCACCACCACCACCACCATCATCATCATCACCGCGACACGAGGACAAGCCT
CACAGCATGTCCGGCTCGTGCTGCGTGGCCTCATCTTCCTCATCATCATCGCGACTCGCGTCTCCGCTGACGCAC
CCAAACGGCACCTCGATATTCCCTTCGCTTTCGACGACGGAACAACAAGACATAGCTCGCGAGGCCTTATCTCAG
GCCCAAGACGCCATCGTCGCAGATACCTTTGACGAGGAAATGGTTCGCGACGAGTCTGACGCAGGTTATAGCAGC
GATGGCTTCAGCTCTGGCAGCACATCGGCCGAGTCTTCGGTCCGCGATTACCTGTACGAGAACGGGCGACGATAT
CATCGCTTTCGCGAGGGGAGCTACAACTTTCCCAACGACGACGTCGAGCAAGAGGTTGGTCTCTTGAACTCTTTT
GCATTGTCTATACTACCCCTTCATTTTTTCTACTTTTTCTTTTTTATAAAAAACCTGCACTTGGACTAATCAAAC
ATTTTCATGGCAGCGCGAGGATATGAAGCATGCCATGGTCAGACTGCTGTGTAGCCAGAAGTTGCTCTTCGCTCC
CATTGGCGAGCATCCGCAGCAAATTCTCGACATCGGAACCGGCACTGGGATATGGGCCATCGAGGTGGGAGACCA
GTTTCCGAGCGCCCATGTGTTGGGTGTCGATCTGTCGCCTATTCAGCCCGACTGGCTGCCTCCCAATGTGCGCTT
CCTCGTCGACGACGTCGAGTCGACCTGGCTCTATCCACGGAACCATTTCGACTATATACACTCGCGACATACCGT
CATGGCCGTCCGCGACTGGCGACGTCTGTTCCGTCAAGCCTATCAGTAATGCTCCCCAAGAGACCCCGAAAGACA
CAAAAAGCTGACGGCTCCCGATTCCAGACACCTCAAACCCGGCGGCTGGATCGAAGTCCAAGAGATACACCACAA
GCCACGCAGCGCCCGACCGCAAGGCACCGTCCCCCAAGATCACGCCGTCGCCCAATTCTGGTCTCGCGTCAACGA
GGGCCTCACCACGCTGGGCGTCGACCTCGACCGCGCCAGCGGCGGCTTCCTGGCCCAAGCCATGCGCGACGAGGG
CCTCGTCAACCTCACCGAACGCGTCTTCCACGTCCCCATCGGCACCTGGCCCAAGAACAAGGTCCTCAAGACGGT
AGGCCTCTACTGGCGAACTATCCTGCTCGACGGACTGCAGGCCATCGCTTTGGGACCCTTGACTCGTGGCTTGCG
CTGGAATCGTGACCAGGTCGAGCTTTTCCTTATGGATGTGAGGCGCGCCTATCATGATAATGCCGCCCTCATGTA
TATGCCGTTGCATATCGTTTACGCTCAGAAACCCGAGTAAGACGGTTTTTTTTTTGGCGTGCTTGCTTTTTCCCC
CCGTCGTCCTATCCGCGCTCTTACCGGGATTCTGTTCCTGTCAATGCTTGTTACTTTCTTTTGCCGTCTGACATC
CTTGTACCATTTTGACGTCTTTATATCACCCTTTTTCGTCTAGTTTACCCCCCCTTTTTTTTGGCACCTCGAGTC
CTCAGTGTCATCTCGATCACCCTCTGTTCGTCAGTCATCTTTTTTTTTTTCCTTTTGATGTCTTCTTTTTGTTTT
CCCCCTCCTTACCTTGTCCCATGGTCCAGGGTTTCCGTTTTCCGTTGCCATGTTTTCTCCTCTCCCCCGGCCGGT
TCCATCTCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail