Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4266
Gene name
Locationscaffold_337:379..1630
Strand-
Gene length (bp)1251
Transcript length (bp)1251
Coding sequence length (bp)1248
Protein length (aa) 416

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07039 DUF1325 SGF29 tudor-like domain 1.6E-34 286 414

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USW9|SGF29_SCHPO SAGA-associated factor 29 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sgf29 PE=1 SV=2 210 414 3.0E-17
sp|P25554|SGF29_YEAST SAGA-associated factor 29 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGF29 PE=1 SV=2 260 412 9.0E-12

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4266
MANRKGWLSKELRRLQEQLGPYHHQTPSRRRGTTASSSDNKSSDIAKESISVQVRQIGKSSGTDTDNRNAMSQRN
RSGRGSNRNNGNNSHGEEAQIWEACKAQMAEIVTGVNAENESLSELVKLDKDVGSMDPDRVPTDAIKQMEQLCRK
GVKFSEANISSIKAVTEQLKILRAVVVAKEQAEAASASGPGKRAARDSAAAATAATASLYDFDGGGDSPVPSPMA
GGGGGAGSSASARKHGDRSSNRDSMPPKADSVEPQGPAASGSGGGSSSNNNNNRSRVTFSKGDAVAFKPKAPSGE
PSSDWILGEVAAVMGEGKSRRYKVLDIEPDDQSKQKEYRSSASSMIAITPESQADTLRNWEAGKVVLALYPNTTT
FYKAEVHSMDGDLRVNLKFEGENDSTTLQQVERRFVIEYRA
Coding >Ophio5|4266
ATGGCTAATCGAAAGGGTTGGCTTTCCAAAGAGCTCAGAAGGCTACAGGAGCAGCTCGGTCCTTATCATCATCAA
ACCCCGTCACGCAGACGAGGCACGACAGCCAGCAGCAGCGACAACAAGAGCAGCGATATCGCCAAAGAAAGCATC
TCAGTTCAAGTCAGACAAATAGGCAAAAGCTCCGGTACAGACACCGACAATCGCAACGCCATGTCTCAACGCAAC
CGCAGTGGTCGTGGGTCCAACCGTAACAACGGTAACAACTCGCACGGTGAGGAGGCGCAGATCTGGGAGGCGTGC
AAAGCGCAGATGGCGGAAATCGTTACGGGCGTCAACGCCGAGAACGAAAGCCTCTCGGAGCTCGTCAAACTGGAC
AAGGACGTGGGCTCGATGGACCCGGACAGGGTGCCGACGGACGCCATCAAGCAGATGGAGCAGCTGTGCCGAAAA
GGGGTGAAGTTCTCCGAGGCCAACATCTCGAGCATCAAGGCGGTGACGGAACAGCTCAAGATCCTACGGGCCGTG
GTGGTGGCCAAAGAGCAGGCCGAGGCGGCGTCGGCGTCGGGCCCGGGTAAGAGAGCGGCCCGAGACAGCGCGGCG
GCGGCGACGGCGGCGACGGCGTCACTCTACGACTTTGACGGCGGCGGCGACTCTCCGGTACCGAGCCCGATGGCC
GGCGGAGGGGGCGGCGCCGGCTCCTCGGCGTCGGCACGCAAGCACGGCGACCGATCGAGCAACCGCGACAGCATG
CCGCCCAAGGCCGACAGCGTCGAGCCGCAGGGCCCCGCGGCGTCGGGCAGCGGCGGCGGAAGCAGCAGCAACAAC
AACAACAACCGATCCCGCGTCACCTTTTCCAAGGGCGACGCCGTAGCCTTTAAGCCTAAGGCGCCGAGCGGCGAG
CCGTCGTCGGATTGGATCCTGGGCGAGGTGGCGGCAGTCATGGGCGAGGGTAAGAGCCGACGCTACAAGGTGCTC
GACATCGAGCCGGACGACCAGAGCAAGCAAAAGGAGTACCGGTCCAGCGCCAGCAGCATGATTGCCATTACGCCT
GAGAGCCAGGCGGACACGCTGCGTAACTGGGAGGCCGGGAAAGTGGTGCTGGCATTGTACCCCAACACGACGACG
TTTTACAAGGCCGAGGTGCACAGCATGGATGGCGACTTGCGGGTCAATCTCAAGTTTGAGGGGGAGAACGACTCG
ACGACGTTGCAGCAGGTGGAGAGGCGGTTTGTGATTGAGTATCGGGCT
Transcript >Ophio5|4266
ATGGCTAATCGAAAGGGTTGGCTTTCCAAAGAGCTCAGAAGGCTACAGGAGCAGCTCGGTCCTTATCATCATCAA
ACCCCGTCACGCAGACGAGGCACGACAGCCAGCAGCAGCGACAACAAGAGCAGCGATATCGCCAAAGAAAGCATC
TCAGTTCAAGTCAGACAAATAGGCAAAAGCTCCGGTACAGACACCGACAATCGCAACGCCATGTCTCAACGCAAC
CGCAGTGGTCGTGGGTCCAACCGTAACAACGGTAACAACTCGCACGGTGAGGAGGCGCAGATCTGGGAGGCGTGC
AAAGCGCAGATGGCGGAAATCGTTACGGGCGTCAACGCCGAGAACGAAAGCCTCTCGGAGCTCGTCAAACTGGAC
AAGGACGTGGGCTCGATGGACCCGGACAGGGTGCCGACGGACGCCATCAAGCAGATGGAGCAGCTGTGCCGAAAA
GGGGTGAAGTTCTCCGAGGCCAACATCTCGAGCATCAAGGCGGTGACGGAACAGCTCAAGATCCTACGGGCCGTG
GTGGTGGCCAAAGAGCAGGCCGAGGCGGCGTCGGCGTCGGGCCCGGGTAAGAGAGCGGCCCGAGACAGCGCGGCG
GCGGCGACGGCGGCGACGGCGTCACTCTACGACTTTGACGGCGGCGGCGACTCTCCGGTACCGAGCCCGATGGCC
GGCGGAGGGGGCGGCGCCGGCTCCTCGGCGTCGGCACGCAAGCACGGCGACCGATCGAGCAACCGCGACAGCATG
CCGCCCAAGGCCGACAGCGTCGAGCCGCAGGGCCCCGCGGCGTCGGGCAGCGGCGGCGGAAGCAGCAGCAACAAC
AACAACAACCGATCCCGCGTCACCTTTTCCAAGGGCGACGCCGTAGCCTTTAAGCCTAAGGCGCCGAGCGGCGAG
CCGTCGTCGGATTGGATCCTGGGCGAGGTGGCGGCAGTCATGGGCGAGGGTAAGAGCCGACGCTACAAGGTGCTC
GACATCGAGCCGGACGACCAGAGCAAGCAAAAGGAGTACCGGTCCAGCGCCAGCAGCATGATTGCCATTACGCCT
GAGAGCCAGGCGGACACGCTGCGTAACTGGGAGGCCGGGAAAGTGGTGCTGGCATTGTACCCCAACACGACGACG
TTTTACAAGGCCGAGGTGCACAGCATGGATGGCGACTTGCGGGTCAATCTCAAGTTTGAGGGGGAGAACGACTCG
ACGACGTTGCAGCAGGTGGAGAGGCGGTTTGTGATTGAGTATCGGGCTTGA
Gene >Ophio5|4266
ATGGCTAATCGAAAGGGTTGGCTTTCCAAAGAGCTCAGAAGGCTACAGGAGCAGCTCGGTCCTTATCATCATCAA
ACCCCGTCACGCAGACGAGGCACGACAGCCAGCAGCAGCGACAACAAGAGCAGCGATATCGCCAAAGAAAGCATC
TCAGTTCAAGTCAGACAAATAGGCAAAAGCTCCGGTACAGACACCGACAATCGCAACGCCATGTCTCAACGCAAC
CGCAGTGGTCGTGGGTCCAACCGTAACAACGGTAACAACTCGCACGGTGAGGAGGCGCAGATCTGGGAGGCGTGC
AAAGCGCAGATGGCGGAAATCGTTACGGGCGTCAACGCCGAGAACGAAAGCCTCTCGGAGCTCGTCAAACTGGAC
AAGGACGTGGGCTCGATGGACCCGGACAGGGTGCCGACGGACGCCATCAAGCAGATGGAGCAGCTGTGCCGAAAA
GGGGTGAAGTTCTCCGAGGCCAACATCTCGAGCATCAAGGCGGTGACGGAACAGCTCAAGATCCTACGGGCCGTG
GTGGTGGCCAAAGAGCAGGCCGAGGCGGCGTCGGCGTCGGGCCCGGGTAAGAGAGCGGCCCGAGACAGCGCGGCG
GCGGCGACGGCGGCGACGGCGTCACTCTACGACTTTGACGGCGGCGGCGACTCTCCGGTACCGAGCCCGATGGCC
GGCGGAGGGGGCGGCGCCGGCTCCTCGGCGTCGGCACGCAAGCACGGCGACCGATCGAGCAACCGCGACAGCATG
CCGCCCAAGGCCGACAGCGTCGAGCCGCAGGGCCCCGCGGCGTCGGGCAGCGGCGGCGGAAGCAGCAGCAACAAC
AACAACAACCGATCCCGCGTCACCTTTTCCAAGGGCGACGCCGTAGCCTTTAAGCCTAAGGCGCCGAGCGGCGAG
CCGTCGTCGGATTGGATCCTGGGCGAGGTGGCGGCAGTCATGGGCGAGGGTAAGAGCCGACGCTACAAGGTGCTC
GACATCGAGCCGGACGACCAGAGCAAGCAAAAGGAGTACCGGTCCAGCGCCAGCAGCATGATTGCCATTACGCCT
GAGAGCCAGGCGGACACGCTGCGTAACTGGGAGGCCGGGAAAGTGGTGCTGGCATTGTACCCCAACACGACGACG
TTTTACAAGGCCGAGGTGCACAGCATGGATGGCGACTTGCGGGTCAATCTCAAGTTTGAGGGGGAGAACGACTCG
ACGACGTTGCAGCAGGTGGAGAGGCGGTTTGTGATTGAGTATCGGGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail