Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4265
Gene name
Locationscaffold_336:21209..21944
Strand-
Gene length (bp)735
Transcript length (bp)591
Coding sequence length (bp)588
Protein length (aa) 196

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09730|SFT1_SCHPO Protein transport protein sft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sft1 PE=3 SV=1 109 196 4.0E-10
sp|P43682|SFT1_YEAST Protein transport protein SFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFT1 PE=1 SV=1 105 195 3.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 88 105 17
3 173 192 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 164.76 90.12 239.39
CcL In ants, during behavior modification 167.94 87.54 248.34
CcD In ants, recently dead 207.82 113.27 302.37

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.948638 no
SC16a CcD 0.334686 no
CcL CcD 0.392993 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4265
MSSSSFFFFATYLSISHWPIAASLSLPPPHTHAPPLTRIGPRIASLAHLFCSLSLSLSLAHAAHGAADDVPSLSK
RIDGDDDDDDVDVIIIFFFFFFFIMAEAYERERQNNARLDELSAKVSALRGVTIDIYDNARAQDVIDNTSDTFSS
MATQIKGSASRLTRMAAAGNKVAVLKLSAIIIALFLVLYYSLKLFL
Coding >Ophio5|4265
ATGTCATCATCATCTTTTTTTTTTTTTGCCACATACCTCAGTATTTCGCACTGGCCTATTGCAGCATCCCTTTCT
CTTCCCCCCCCACACACACACGCTCCTCCCCTAACTCGTATCGGACCACGAATCGCCTCGCTCGCTCACCTCTTC
TGCTCTCTCTCTCTCTCTCTCTCTCTCGCGCATGCCGCCCACGGCGCGGCCGACGACGTACCGAGTCTATCGAAA
CGAATCGACGGCGACGACGACGACGACGACGTCGACGTCATCATCATCTTCTTCTTCTTCTTCTTCTTCATCATG
GCTGAAGCTTACGAGCGCGAGAGGCAAAATAATGCCCGTCTTGATGAGTTGTCTGCCAAGGTCTCTGCCCTGCGC
GGCGTCACCATCGACATCTACGACAATGCTCGTGCCCAAGACGTCATCGACAATACCTCCGACACCTTCTCCTCC
ATGGCCACCCAGATCAAGGGTTCGGCTTCCCGCCTCACCCGCATGGCTGCCGCCGGGAACAAGGTTGCCGTCTTG
AAGCTGTCTGCCATCATCATCGCCCTGTTCCTCGTCCTCTACTACAGCCTCAAACTATTCTTG
Transcript >Ophio5|4265
ATGTCATCATCATCTTTTTTTTTTTTTGCCACATACCTCAGTATTTCGCACTGGCCTATTGCAGCATCCCTTTCT
CTTCCCCCCCCACACACACACGCTCCTCCCCTAACTCGTATCGGACCACGAATCGCCTCGCTCGCTCACCTCTTC
TGCTCTCTCTCTCTCTCTCTCTCTCTCGCGCATGCCGCCCACGGCGCGGCCGACGACGTACCGAGTCTATCGAAA
CGAATCGACGGCGACGACGACGACGACGACGTCGACGTCATCATCATCTTCTTCTTCTTCTTCTTCTTCATCATG
GCTGAAGCTTACGAGCGCGAGAGGCAAAATAATGCCCGTCTTGATGAGTTGTCTGCCAAGGTCTCTGCCCTGCGC
GGCGTCACCATCGACATCTACGACAATGCTCGTGCCCAAGACGTCATCGACAATACCTCCGACACCTTCTCCTCC
ATGGCCACCCAGATCAAGGGTTCGGCTTCCCGCCTCACCCGCATGGCTGCCGCCGGGAACAAGGTTGCCGTCTTG
AAGCTGTCTGCCATCATCATCGCCCTGTTCCTCGTCCTCTACTACAGCCTCAAACTATTCTTGTAG
Gene >Ophio5|4265
ATGTCATCATCATCTTTTTTTTTTTTTGCCACATACCTCAGTATTTCGCACTGGCCTATTGCAGCATCCCTTTCT
CTTCCCCCCCCACACACACACGCTCCTCCCCTAACTCGTATCGGACCACGAATCGCCTCGCTCGCTCACCTCTTC
TGCTCTCTCTCTCTCTCTCTCTCTCTCGCGCATGCCGCCCACGGCGCGGCCGACGACGTACCGAGTCTATCGAAA
CGAATCGACGGCGACGACGACGACGACGACGTCGACGTCATCATCATCTTCTTCTTCTTCTTCTTCTTCATCATG
GCTGAAGCTTACGAGCGCGAGAGGCAAAATAATGCCCGTCTTGATGAGTTGTCTGCCAAGGTCTCTGCCCTGCGC
GGCGTCACCATCGACATCTACGACAATGCTCGTGCCCAAGACGTCATCGACAATACCGTTCGTTCCTCCTTTTCC
ATCTTTCCATCTTTCTTTCTTTCTTTCATCTTCATCTTCTTCTTCCTCTTCGCAACTCTCCTCCCCTTTCTTCCT
CGTGGCCCCCTTCATGACCATGCTGACACGCTCGCTCTAAAAAAAAAAAAGTCCGACACCTTCTCCTCCATGGCC
ACCCAGATCAAGGGTTCGGCTTCCCGCCTCACCCGCATGGCTGCCGCCGGGAACAAGGTTGCCGTCTTGAAGCTG
TCTGCCATCATCATCGCCCTGTTCCTCGTCCTCTACTACAGCCTCAAACTATTCTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail