Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4265
Gene name
Locationscaffold_336:21209..21944
Strand-
Gene length (bp)735
Transcript length (bp)591
Coding sequence length (bp)588
Protein length (aa) 196

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09730|SFT1_SCHPO Protein transport protein sft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sft1 PE=3 SV=1 109 196 4.0E-10
sp|P43682|SFT1_YEAST Protein transport protein SFT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFT1 PE=1 SV=1 105 195 3.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

Domain # Start End Length
1 5 27 22
2 88 105 17
3 173 192 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4265
MSSSSFFFFATYLSISHWPIAASLSLPPPHTHAPPLTRIGPRIASLAHLFCSLSLSLSLAHAAHGAADDVPSLSK
RIDGDDDDDDVDVIIIFFFFFFFIMAEAYERERQNNARLDELSAKVSALRGVTIDIYDNARAQDVIDNTSDTFSS
MATQIKGSASRLTRMAAAGNKVAVLKLSAIIIALFLVLYYSLKLFL
Coding >Ophio5|4265
ATGTCATCATCATCTTTTTTTTTTTTTGCCACATACCTCAGTATTTCGCACTGGCCTATTGCAGCATCCCTTTCT
CTTCCCCCCCCACACACACACGCTCCTCCCCTAACTCGTATCGGACCACGAATCGCCTCGCTCGCTCACCTCTTC
TGCTCTCTCTCTCTCTCTCTCTCTCTCGCGCATGCCGCCCACGGCGCGGCCGACGACGTACCGAGTCTATCGAAA
CGAATCGACGGCGACGACGACGACGACGACGTCGACGTCATCATCATCTTCTTCTTCTTCTTCTTCTTCATCATG
GCTGAAGCTTACGAGCGCGAGAGGCAAAATAATGCCCGTCTTGATGAGTTGTCTGCCAAGGTCTCTGCCCTGCGC
GGCGTCACCATCGACATCTACGACAATGCTCGTGCCCAAGACGTCATCGACAATACCTCCGACACCTTCTCCTCC
ATGGCCACCCAGATCAAGGGTTCGGCTTCCCGCCTCACCCGCATGGCTGCCGCCGGGAACAAGGTTGCCGTCTTG
AAGCTGTCTGCCATCATCATCGCCCTGTTCCTCGTCCTCTACTACAGCCTCAAACTATTCTTG
Transcript >Ophio5|4265
ATGTCATCATCATCTTTTTTTTTTTTTGCCACATACCTCAGTATTTCGCACTGGCCTATTGCAGCATCCCTTTCT
CTTCCCCCCCCACACACACACGCTCCTCCCCTAACTCGTATCGGACCACGAATCGCCTCGCTCGCTCACCTCTTC
TGCTCTCTCTCTCTCTCTCTCTCTCTCGCGCATGCCGCCCACGGCGCGGCCGACGACGTACCGAGTCTATCGAAA
CGAATCGACGGCGACGACGACGACGACGACGTCGACGTCATCATCATCTTCTTCTTCTTCTTCTTCTTCATCATG
GCTGAAGCTTACGAGCGCGAGAGGCAAAATAATGCCCGTCTTGATGAGTTGTCTGCCAAGGTCTCTGCCCTGCGC
GGCGTCACCATCGACATCTACGACAATGCTCGTGCCCAAGACGTCATCGACAATACCTCCGACACCTTCTCCTCC
ATGGCCACCCAGATCAAGGGTTCGGCTTCCCGCCTCACCCGCATGGCTGCCGCCGGGAACAAGGTTGCCGTCTTG
AAGCTGTCTGCCATCATCATCGCCCTGTTCCTCGTCCTCTACTACAGCCTCAAACTATTCTTGTAG
Gene >Ophio5|4265
ATGTCATCATCATCTTTTTTTTTTTTTGCCACATACCTCAGTATTTCGCACTGGCCTATTGCAGCATCCCTTTCT
CTTCCCCCCCCACACACACACGCTCCTCCCCTAACTCGTATCGGACCACGAATCGCCTCGCTCGCTCACCTCTTC
TGCTCTCTCTCTCTCTCTCTCTCTCTCGCGCATGCCGCCCACGGCGCGGCCGACGACGTACCGAGTCTATCGAAA
CGAATCGACGGCGACGACGACGACGACGACGTCGACGTCATCATCATCTTCTTCTTCTTCTTCTTCTTCATCATG
GCTGAAGCTTACGAGCGCGAGAGGCAAAATAATGCCCGTCTTGATGAGTTGTCTGCCAAGGTCTCTGCCCTGCGC
GGCGTCACCATCGACATCTACGACAATGCTCGTGCCCAAGACGTCATCGACAATACCGTTCGTTCCTCCTTTTCC
ATCTTTCCATCTTTCTTTCTTTCTTTCATCTTCATCTTCTTCTTCCTCTTCGCAACTCTCCTCCCCTTTCTTCCT
CGTGGCCCCCTTCATGACCATGCTGACACGCTCGCTCTAAAAAAAAAAAAGTCCGACACCTTCTCCTCCATGGCC
ACCCAGATCAAGGGTTCGGCTTCCCGCCTCACCCGCATGGCTGCCGCCGGGAACAAGGTTGCCGTCTTGAAGCTG
TCTGCCATCATCATCGCCCTGTTCCTCGTCCTCTACTACAGCCTCAAACTATTCTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail