Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4248
Gene name
Locationscaffold_334:21731..22427
Strand+
Gene length (bp)696
Transcript length (bp)696
Coding sequence length (bp)693
Protein length (aa) 231

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14566 PTPlike_phytase Inositol hexakisphosphate 3.0E-06 125 185

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4248
MKSLFCSSLFQGLFALLLCLCAARLVDADSNQPSLSEPQPVEIHPNLWRRQSRTDPEGGGLHRFEKVVTEFLSPE
DELYRSSAPFYTGSDSSQKVRGSTVQALREKKITLVISLNSEAVNDDFLRLFSANKIEYRAVPVKDYGAPAKQQL
EEVTDAFLAHRGKGGTLVHCGHGSGRTGTAVSAIEMRVQSTLPPDVRKLLTPDDLKANLVETPRQIDVLGEYQRR
LSPVCG
Coding >Ophio5|4248
ATGAAGTCGCTCTTTTGCTCGTCCTTGTTTCAAGGCCTCTTTGCTTTGCTCCTCTGCCTCTGCGCCGCGCGGCTT
GTGGATGCCGACTCCAACCAACCTTCGCTATCCGAGCCTCAGCCCGTCGAAATCCATCCAAATCTTTGGCGGAGA
CAGAGTCGGACTGATCCGGAGGGGGGCGGACTCCACCGATTCGAGAAAGTAGTGACAGAGTTTCTCTCGCCCGAA
GATGAACTTTATCGCTCCTCTGCACCGTTTTACACAGGTTCCGATAGTAGCCAGAAAGTCCGCGGGAGTACAGTT
CAGGCGCTTCGGGAGAAGAAAATCACGCTCGTCATCAGTTTAAACAGCGAAGCCGTAAACGACGACTTCCTTCGG
CTCTTCTCGGCGAATAAGATTGAGTACCGGGCAGTGCCTGTGAAGGATTATGGCGCTCCGGCGAAACAGCAGCTG
GAAGAAGTAACCGATGCCTTCCTCGCTCACCGGGGAAAGGGCGGAACATTGGTCCATTGTGGCCATGGATCGGGG
CGAACAGGAACGGCAGTATCTGCTATTGAGATGCGCGTCCAGTCAACGCTTCCACCCGATGTCCGCAAATTACTC
ACGCCAGATGACTTGAAGGCCAATCTAGTCGAGACCCCTCGTCAGATAGATGTATTGGGAGAGTACCAACGCCGG
CTTTCACCTGTATGTGGG
Transcript >Ophio5|4248
ATGAAGTCGCTCTTTTGCTCGTCCTTGTTTCAAGGCCTCTTTGCTTTGCTCCTCTGCCTCTGCGCCGCGCGGCTT
GTGGATGCCGACTCCAACCAACCTTCGCTATCCGAGCCTCAGCCCGTCGAAATCCATCCAAATCTTTGGCGGAGA
CAGAGTCGGACTGATCCGGAGGGGGGCGGACTCCACCGATTCGAGAAAGTAGTGACAGAGTTTCTCTCGCCCGAA
GATGAACTTTATCGCTCCTCTGCACCGTTTTACACAGGTTCCGATAGTAGCCAGAAAGTCCGCGGGAGTACAGTT
CAGGCGCTTCGGGAGAAGAAAATCACGCTCGTCATCAGTTTAAACAGCGAAGCCGTAAACGACGACTTCCTTCGG
CTCTTCTCGGCGAATAAGATTGAGTACCGGGCAGTGCCTGTGAAGGATTATGGCGCTCCGGCGAAACAGCAGCTG
GAAGAAGTAACCGATGCCTTCCTCGCTCACCGGGGAAAGGGCGGAACATTGGTCCATTGTGGCCATGGATCGGGG
CGAACAGGAACGGCAGTATCTGCTATTGAGATGCGCGTCCAGTCAACGCTTCCACCCGATGTCCGCAAATTACTC
ACGCCAGATGACTTGAAGGCCAATCTAGTCGAGACCCCTCGTCAGATAGATGTATTGGGAGAGTACCAACGCCGG
CTTTCACCTGTATGTGGGTAA
Gene >Ophio5|4248
ATGAAGTCGCTCTTTTGCTCGTCCTTGTTTCAAGGCCTCTTTGCTTTGCTCCTCTGCCTCTGCGCCGCGCGGCTT
GTGGATGCCGACTCCAACCAACCTTCGCTATCCGAGCCTCAGCCCGTCGAAATCCATCCAAATCTTTGGCGGAGA
CAGAGTCGGACTGATCCGGAGGGGGGCGGACTCCACCGATTCGAGAAAGTAGTGACAGAGTTTCTCTCGCCCGAA
GATGAACTTTATCGCTCCTCTGCACCGTTTTACACAGGTTCCGATAGTAGCCAGAAAGTCCGCGGGAGTACAGTT
CAGGCGCTTCGGGAGAAGAAAATCACGCTCGTCATCAGTTTAAACAGCGAAGCCGTAAACGACGACTTCCTTCGG
CTCTTCTCGGCGAATAAGATTGAGTACCGGGCAGTGCCTGTGAAGGATTATGGCGCTCCGGCGAAACAGCAGCTG
GAAGAAGTAACCGATGCCTTCCTCGCTCACCGGGGAAAGGGCGGAACATTGGTCCATTGTGGCCATGGATCGGGG
CGAACAGGAACGGCAGTATCTGCTATTGAGATGCGCGTCCAGTCAACGCTTCCACCCGATGTCCGCAAATTACTC
ACGCCAGATGACTTGAAGGCCAATCTAGTCGAGACCCCTCGTCAGATAGATGTATTGGGAGAGTACCAACGCCGG
CTTTCACCTGTATGTGGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail