Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4234
Gene name
Locationscaffold_333:6375..7359
Strand+
Gene length (bp)984
Transcript length (bp)984
Coding sequence length (bp)981
Protein length (aa) 327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07574 SMC_Nse1 Nse1 non-SMC component of SMC5-6 complex 7.6E-66 14 202
PF08746 zf-RING-like RING-like domain 7.1E-14 226 268

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3T0X7|NSE1_BOVIN Non-structural maintenance of chromosomes element 1 homolog OS=Bos taurus GN=NSMCE1 PE=2 SV=2 12 272 1.0E-13
sp|Q8WV22|NSE1_HUMAN Non-structural maintenance of chromosomes element 1 homolog OS=Homo sapiens GN=NSMCE1 PE=1 SV=5 12 272 3.0E-13
sp|Q6P881|NSE1_XENTR Non-structural maintenance of chromosomes element 1 homolog OS=Xenopus tropicalis GN=nsmce1 PE=2 SV=1 11 304 4.0E-13
sp|Q499U6|NSE1_RAT Non-structural maintenance of chromosomes element 1 homolog OS=Rattus norvegicus GN=Nsmce1 PE=2 SV=2 12 272 6.0E-13
sp|Q9D720|NSE1_MOUSE Non-structural maintenance of chromosomes element 1 homolog OS=Mus musculus GN=Nsmce1 PE=1 SV=1 12 272 7.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3T0X7|NSE1_BOVIN Non-structural maintenance of chromosomes element 1 homolog OS=Bos taurus GN=NSMCE1 PE=2 SV=2 12 272 1.0E-13
sp|Q8WV22|NSE1_HUMAN Non-structural maintenance of chromosomes element 1 homolog OS=Homo sapiens GN=NSMCE1 PE=1 SV=5 12 272 3.0E-13
sp|Q6P881|NSE1_XENTR Non-structural maintenance of chromosomes element 1 homolog OS=Xenopus tropicalis GN=nsmce1 PE=2 SV=1 11 304 4.0E-13
sp|Q499U6|NSE1_RAT Non-structural maintenance of chromosomes element 1 homolog OS=Rattus norvegicus GN=Nsmce1 PE=2 SV=2 12 272 6.0E-13
sp|Q9D720|NSE1_MOUSE Non-structural maintenance of chromosomes element 1 homolog OS=Mus musculus GN=Nsmce1 PE=1 SV=1 12 272 7.0E-13
sp|Q5RAZ5|NSE1_PONAB Non-structural maintenance of chromosomes element 1 homolog OS=Pongo abelii GN=NSMCE1 PE=2 SV=1 12 272 1.0E-12
sp|Q53EK2|NSE1_SCHPO Non-structural maintenance of chromosomes element 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nse1 PE=1 SV=1 9 279 2.0E-12
sp|Q6DGT7|NSE1_DANRE Non-structural maintenance of chromosomes element 1 homolog OS=Danio rerio GN=nsmce1 PE=2 SV=1 170 272 3.0E-11
sp|Q6PAF4|NSE1_XENLA Non-structural maintenance of chromosomes element 1 homolog OS=Xenopus laevis GN=nsmce1 PE=2 SV=1 11 272 1.0E-10
sp|Q07913|NSE1_YEAST Non-structural maintenance of chromosomes element 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSE1 PE=1 SV=1 40 244 7.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0006281 DNA repair Yes
GO:0030915 Smc5-Smc6 complex Yes
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0106068 SUMO ligase complex No
GO:0032991 protein-containing complex No
GO:0050896 response to stimulus No
GO:0006259 DNA metabolic process No
GO:0044238 primary metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1902494 catalytic complex No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0033554 cellular response to stress No
GO:1990234 transferase complex No
GO:0044260 cellular macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:1901360 organic cyclic compound metabolic process No
GO:0051716 cellular response to stimulus No
GO:0006807 nitrogen compound metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006950 response to stress No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4234
MEQDLLRRGYDDSHRAFLQALLARGTVTFEESQSILAAIVNAKNGANGGTRPEQVSQEFFESYLDMVSEAASMFD
YEIRSTVHQLTKQRIYALVNTTSDPQTQLATTYNAEELAFIKRLLDGIFDKYNRPRMEVFAITEMQAIKFARPNR
RLSRTGEAEPSSDKGLKHSEVERVLAGLVDGGWLEKSKSGFYSVTPRALLELRPWLIDMYNDGDAGQDDWQRIKF
CEACKDIVTAGLRCADPSCTLRLHDICQEAFWRVRRTTSCPKCSREWTGTSFVGERAVTSTEAYQRGRRRGGGRR
STLADQVMENQGFEEGSDGEQENGQDE
Coding >Ophio5|4234
ATGGAACAAGACCTCCTGAGGCGCGGCTACGACGACAGCCACCGCGCATTTCTGCAGGCGCTCCTGGCCCGCGGC
ACAGTTACATTCGAGGAGTCGCAATCGATACTCGCGGCCATCGTCAACGCGAAGAACGGCGCGAATGGAGGGACG
CGCCCCGAGCAAGTGAGCCAGGAGTTTTTCGAGTCATACCTGGACATGGTCTCGGAAGCGGCCTCCATGTTCGAC
TACGAGATTCGCAGTACCGTGCACCAGCTCACGAAGCAACGGATCTACGCCCTCGTCAACACCACATCAGACCCT
CAGACGCAGCTCGCAACAACATACAACGCCGAGGAGCTGGCCTTCATCAAGCGATTACTCGACGGCATCTTCGAC
AAGTACAACAGGCCGCGGATGGAGGTGTTCGCCATCACGGAGATGCAGGCCATCAAGTTTGCGAGACCGAACCGG
AGGCTGAGCCGGACGGGTGAAGCCGAGCCGTCGAGCGACAAGGGGCTGAAGCACAGCGAGGTAGAGCGAGTCCTG
GCAGGCCTCGTTGACGGGGGGTGGCTGGAGAAGAGCAAAAGCGGTTTCTACTCGGTCACGCCGCGAGCGCTGCTG
GAGTTGCGGCCGTGGCTCATCGACATGTACAACGATGGCGATGCCGGCCAGGACGACTGGCAGCGCATCAAGTTC
TGCGAGGCCTGCAAGGACATTGTCACGGCGGGACTGCGATGCGCCGACCCCTCCTGCACGCTGCGGCTGCATGAC
ATCTGCCAGGAGGCCTTCTGGAGGGTGCGCAGGACGACAAGCTGTCCCAAGTGCTCGCGAGAGTGGACGGGAACG
AGCTTTGTCGGGGAGCGGGCCGTCACCTCGACAGAGGCCTATCAGAGGGGACGCAGACGAGGTGGCGGCAGGAGG
AGCACGCTGGCGGACCAGGTCATGGAGAATCAGGGATTCGAGGAAGGGAGCGACGGCGAGCAAGAGAATGGCCAG
GACGAA
Transcript >Ophio5|4234
ATGGAACAAGACCTCCTGAGGCGCGGCTACGACGACAGCCACCGCGCATTTCTGCAGGCGCTCCTGGCCCGCGGC
ACAGTTACATTCGAGGAGTCGCAATCGATACTCGCGGCCATCGTCAACGCGAAGAACGGCGCGAATGGAGGGACG
CGCCCCGAGCAAGTGAGCCAGGAGTTTTTCGAGTCATACCTGGACATGGTCTCGGAAGCGGCCTCCATGTTCGAC
TACGAGATTCGCAGTACCGTGCACCAGCTCACGAAGCAACGGATCTACGCCCTCGTCAACACCACATCAGACCCT
CAGACGCAGCTCGCAACAACATACAACGCCGAGGAGCTGGCCTTCATCAAGCGATTACTCGACGGCATCTTCGAC
AAGTACAACAGGCCGCGGATGGAGGTGTTCGCCATCACGGAGATGCAGGCCATCAAGTTTGCGAGACCGAACCGG
AGGCTGAGCCGGACGGGTGAAGCCGAGCCGTCGAGCGACAAGGGGCTGAAGCACAGCGAGGTAGAGCGAGTCCTG
GCAGGCCTCGTTGACGGGGGGTGGCTGGAGAAGAGCAAAAGCGGTTTCTACTCGGTCACGCCGCGAGCGCTGCTG
GAGTTGCGGCCGTGGCTCATCGACATGTACAACGATGGCGATGCCGGCCAGGACGACTGGCAGCGCATCAAGTTC
TGCGAGGCCTGCAAGGACATTGTCACGGCGGGACTGCGATGCGCCGACCCCTCCTGCACGCTGCGGCTGCATGAC
ATCTGCCAGGAGGCCTTCTGGAGGGTGCGCAGGACGACAAGCTGTCCCAAGTGCTCGCGAGAGTGGACGGGAACG
AGCTTTGTCGGGGAGCGGGCCGTCACCTCGACAGAGGCCTATCAGAGGGGACGCAGACGAGGTGGCGGCAGGAGG
AGCACGCTGGCGGACCAGGTCATGGAGAATCAGGGATTCGAGGAAGGGAGCGACGGCGAGCAAGAGAATGGCCAG
GACGAATAA
Gene >Ophio5|4234
ATGGAACAAGACCTCCTGAGGCGCGGCTACGACGACAGCCACCGCGCATTTCTGCAGGCGCTCCTGGCCCGCGGC
ACAGTTACATTCGAGGAGTCGCAATCGATACTCGCGGCCATCGTCAACGCGAAGAACGGCGCGAATGGAGGGACG
CGCCCCGAGCAAGTGAGCCAGGAGTTTTTCGAGTCATACCTGGACATGGTCTCGGAAGCGGCCTCCATGTTCGAC
TACGAGATTCGCAGTACCGTGCACCAGCTCACGAAGCAACGGATCTACGCCCTCGTCAACACCACATCAGACCCT
CAGACGCAGCTCGCAACAACATACAACGCCGAGGAGCTGGCCTTCATCAAGCGATTACTCGACGGCATCTTCGAC
AAGTACAACAGGCCGCGGATGGAGGTGTTCGCCATCACGGAGATGCAGGCCATCAAGTTTGCGAGACCGAACCGG
AGGCTGAGCCGGACGGGTGAAGCCGAGCCGTCGAGCGACAAGGGGCTGAAGCACAGCGAGGTAGAGCGAGTCCTG
GCAGGCCTCGTTGACGGGGGGTGGCTGGAGAAGAGCAAAAGCGGTTTCTACTCGGTCACGCCGCGAGCGCTGCTG
GAGTTGCGGCCGTGGCTCATCGACATGTACAACGATGGCGATGCCGGCCAGGACGACTGGCAGCGCATCAAGTTC
TGCGAGGCCTGCAAGGACATTGTCACGGCGGGACTGCGATGCGCCGACCCCTCCTGCACGCTGCGGCTGCATGAC
ATCTGCCAGGAGGCCTTCTGGAGGGTGCGCAGGACGACAAGCTGTCCCAAGTGCTCGCGAGAGTGGACGGGAACG
AGCTTTGTCGGGGAGCGGGCCGTCACCTCGACAGAGGCCTATCAGAGGGGACGCAGACGAGGTGGCGGCAGGAGG
AGCACGCTGGCGGACCAGGTCATGGAGAATCAGGGATTCGAGGAAGGGAGCGACGGCGAGCAAGAGAATGGCCAG
GACGAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail