Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4224
Gene name
Locationscaffold_332:144..1240
Strand-
Gene length (bp)1096
Transcript length (bp)1047
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 16.60 6.60 26.60
CcL In ants, during behavior modification 9.41 3.12 15.69
CcD In ants, recently dead 12.41 4.53 20.30

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.069983 no
SC16a CcD 0.372046 no
CcL CcD 0.426235 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4224
MKINSLTVAAALVAGAMAAPSMQAADRQQSSNNQQAAEKQQKVTANNSSNAMLTISKQDLEGICGICDPCLEGDV
HGPPEDCKAICSSNGNKKCDRKAADKSAKTGKDSDAHVAGNKVDEKLAETGNDSDAKTPEKRQASELPKAPKKLQ
QAAKNLDDAKNNAGKAKNTVNVRQRNVENICAICDPCPNVTKRSLQTPAAATCSLLCQSVLHKDCAAGGGGGGGG
GGGGGGGGSSIIINGGNGGNGGSGGGFGNGFGSGFGGGFGNGFGGGNGFGQGGGGGFGQGGGGGFGQGGGGGFGQ
GGGNGFGQAFGNGFGNGFGNGFGDGFGQGGGFGQGGGFGQAAVALEAG
Coding >Ophio5|4224
ATGAAGATCAACTCTCTCACCGTGGCCGCTGCCCTCGTGGCAGGCGCTATGGCCGCGCCTAGCATGCAGGCCGCA
GACAGGCAGCAGTCGTCTAACAACCAGCAGGCCGCCGAGAAGCAGCAAAAGGTCACCGCCAACAACAGCAGCAAC
GCCATGCTCACCATCTCTAAGCAGGACCTCGAGGGCATCTGCGGCATCTGCGACCCGTGCCTGGAAGGTGATGTC
CACGGCCCGCCCGAGGATTGCAAGGCCATCTGCTCCTCCAACGGCAACAAGAAGTGCGACAGAAAGGCTGCCGAC
AAGTCCGCCAAGACTGGCAAGGACTCCGATGCCCACGTCGCCGGTAACAAGGTCGACGAGAAACTCGCCGAAACC
GGTAACGACTCGGACGCGAAGACGCCCGAGAAGCGTCAGGCTTCTGAGCTGCCAAAAGCCCCCAAGAAGCTGCAG
CAGGCCGCCAAGAATCTGGACGACGCCAAGAACAATGCTGGCAAAGCCAAGAACACAGTCAACGTCCGTCAGCGG
AACGTGGAAAACATCTGTGCCATCTGCGACCCCTGCCCCAACGTCACGAAGCGCAGTCTGCAGACTCCGGCAGCA
GCCACCTGCTCCCTCCTCTGCCAGTCTGTGCTCCATAAGGACTGTGCCGCCGGTGGCGGCGGCGGCGGCGGCGGC
GGCGGCGGCGGCGGTGGTGGTGGCAGCAGCATCATCATCAATGGAGGAAATGGCGGCAACGGTGGCAGCGGCGGC
GGCTTTGGCAACGGCTTTGGCAGTGGATTCGGTGGCGGATTCGGCAACGGATTCGGAGGTGGAAACGGCTTCGGC
CAAGGAGGAGGCGGCGGCTTCGGTCAAGGAGGCGGCGGAGGCTTCGGCCAAGGAGGCGGCGGAGGCTTTGGTCAA
GGAGGTGGCAACGGCTTCGGCCAAGCCTTCGGCAACGGCTTCGGCAACGGCTTCGGCAACGGCTTCGGCGATGGC
TTCGGCCAAGGGGGCGGCTTTGGCCAAGGAGGCGGCTTCGGCCAAGCGGCGGTGGCTTTGGAAGCGGGA
Transcript >Ophio5|4224
ATGAAGATCAACTCTCTCACCGTGGCCGCTGCCCTCGTGGCAGGCGCTATGGCCGCGCCTAGCATGCAGGCCGCA
GACAGGCAGCAGTCGTCTAACAACCAGCAGGCCGCCGAGAAGCAGCAAAAGGTCACCGCCAACAACAGCAGCAAC
GCCATGCTCACCATCTCTAAGCAGGACCTCGAGGGCATCTGCGGCATCTGCGACCCGTGCCTGGAAGGTGATGTC
CACGGCCCGCCCGAGGATTGCAAGGCCATCTGCTCCTCCAACGGCAACAAGAAGTGCGACAGAAAGGCTGCCGAC
AAGTCCGCCAAGACTGGCAAGGACTCCGATGCCCACGTCGCCGGTAACAAGGTCGACGAGAAACTCGCCGAAACC
GGTAACGACTCGGACGCGAAGACGCCCGAGAAGCGTCAGGCTTCTGAGCTGCCAAAAGCCCCCAAGAAGCTGCAG
CAGGCCGCCAAGAATCTGGACGACGCCAAGAACAATGCTGGCAAAGCCAAGAACACAGTCAACGTCCGTCAGCGG
AACGTGGAAAACATCTGTGCCATCTGCGACCCCTGCCCCAACGTCACGAAGCGCAGTCTGCAGACTCCGGCAGCA
GCCACCTGCTCCCTCCTCTGCCAGTCTGTGCTCCATAAGGACTGTGCCGCCGGTGGCGGCGGCGGCGGCGGCGGC
GGCGGCGGCGGCGGTGGTGGTGGCAGCAGCATCATCATCAATGGAGGAAATGGCGGCAACGGTGGCAGCGGCGGC
GGCTTTGGCAACGGCTTTGGCAGTGGATTCGGTGGCGGATTCGGCAACGGATTCGGAGGTGGAAACGGCTTCGGC
CAAGGAGGAGGCGGCGGCTTCGGTCAAGGAGGCGGCGGAGGCTTCGGCCAAGGAGGCGGCGGAGGCTTTGGTCAA
GGAGGTGGCAACGGCTTCGGCCAAGCCTTCGGCAACGGCTTCGGCAACGGCTTCGGCAACGGCTTCGGCGATGGC
TTCGGCCAAGGGGGCGGCTTTGGCCAAGGAGGCGGCTTCGGCCAAGCGGCGGTGGCTTTGGAAGCGGGATAG
Gene >Ophio5|4224
ATGAAGATCAACTCTCTCACCGTGGCCGCTGCCCTCGTGGCAGGCGCTATGGCCGCGCCTAGCATGCAGGCCGCA
GACAGGCAGCAGTCGTCTAACAACCAGCAGGCCGCCGAGAAGCAGCAAAAGGTCACCGCCAACAACAGCAGCAAC
GCCATGCTCACCATCTCTAAGCAGGACCTCGAGGGCATCTGCGGCATCTGCGACCCGTGCCTGGAAGGTGATGTC
CACGGCCCGCCCGAGGATTGCAAGGCCATCTGCTCCTCCAACGGCAACAAGAAGTGCGACAGAAAGGCTGCCGAC
AAGTCCGCCAAGACTGGCAAGGACTCCGATGCCCACGTCGCCGGTAACAAGGTCGACGAGAAACTCGCCGAAACC
GGTAACGACTCGGACGCGAAGACGCCCGAGAAGCGTCAGGCTTCTGAGCTGCCAAAAGCCCCCAAGAAGCTGCAG
CAGGCCGCCAAGAATCTGGACGACGCCAAGAACAATGCTGGCAAAGCCAAGAACACAGTCAACGTCCGTCAGCGG
AACGTGGAAAACATCTGTGCCATCTGCGACCCCTGCCCCAACGTCACGAAGCGCAGTCTGCAGACTCCGGCAGCA
GCCACCTGCTCCCTCCTCTGCCAGTCTGTGCTCCATAAGGACTGTGCCGCCGGTGGCGGCGGCGGCGGCGGCGGC
GGCGGCGGCGGCGGTGGTGGTGGCAGCAGCATCATCATCAATGGAGGAAATGGCGGCAACGGTGGCAGCGGCGGC
GGCTTTGGCAACGGCTTTGGCAGTGGATTCGGTGGCGGATTCGGCAACGGATTCGGAGGTGGAAACGGCTTCGGC
CAAGGAGGAGGCGGCGGCTTCGGTCAAGGAGGCGGCGGAGGCTTCGGCCAAGGAGGCGGCGGAGGCTTTGGTCAA
GGAGGTGGCAACGGCTTCGGCCAAGCCTTCGGCAACGGCTTCGGCAACGGCTTCGGCAACGGCTTCGGCGATGGC
TTCGGCCAAGGGGGCGGCTTTGGCCAAGGAGGCGGCTTCGGCCAAGGTGGGGGCAGTGGCTTCGGAGACGGCGGT
TTCGGCTCTGGAGGCGGCAGCGGCGGTGGCTTTGGAAGCGGGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail