Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4222
Gene name
Locationscaffold_331:17668..19673
Strand+
Gene length (bp)2005
Transcript length (bp)1953
Coding sequence length (bp)1950
Protein length (aa) 650

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05686 Glyco_transf_90 Glycosyl transferase family 90 3.3E-11 501 620

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q5K8R6|CXT1_CRYNJ Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CXT1 PE=1 SV=1 82 625 2.0E-44
sp|Q6UW63|KDEL1_HUMAN KDEL motif-containing protein 1 OS=Homo sapiens GN=KDELC1 PE=1 SV=1 507 618 2.0E-08
sp|Q9JHP7|KDEL1_MOUSE KDEL motif-containing protein 1 OS=Mus musculus GN=Kdelc1 PE=1 SV=1 507 618 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 16 33 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 39.71 21.76 57.65
CcL In ants, during behavior modification 14.06 5.86 22.27
CcD In ants, recently dead 7.61 2.90 12.31

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000535 yes
SC16a CcD 0.000286 yes
CcL CcD 0.039666 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4222
MGNKLLSPTTFRRRPSARYAVVAVFILFAFYAFNRSSREIYVNTSSTSIIRHRVPVQLEKPLQPPSPPSPPTIYP
DQSSADGTNHPIDKLIFDAQRSFAGLLSSESKSLEDAAQAYRRRRGRHPPPGFDKWYEFARSRNAVIVEDFFDQI
YHDLEPFWGMDPLSMRRRASQFEMTINVRNGNASAVSDWFWTKIWLGMIKEIEKYLPDMDIALNAMDEPRIVATW
ENVNKHVKKAAVTRRRPRARSVVSDFQKLPGPNKGDLAPKVPEIKWDETEPYWLIARRGCSPNSLARKAPLQTSF
AEPPAISNDYAVQHLHQGYVSNYSKSNEVCHQPDLQGLQGLLIKPISTKATDVLFPMFGGSKLTVNNEILLPAPM
YWNEEERFTGGQDHGDPWAEKADQVIWRGVATGGRNEDDNWRGFQRHRFVAMNNGTKISLIESGKEKPENFALAE
ERYNVSAQREHKLGKWISDVSDVAFIDLFCDPPQDGWCNYTDFYFEPKPALNMATQFDSKYLPDIDGNSFSGRYL
GFLRSSSLPIKASVWREWHDSRLVPWKHFVPMDNRFSDYYGILDYFIGSNDRDGHDEAAERIASDGKEWAERVLR
KEDMLIYVLRLLLEYARVVDKRRESMGWVDDILKDPSLEQPQPGRWWLLS
Coding >Ophio5|4222
ATGGGCAACAAACTCTTATCCCCGACAACGTTCCGCCGACGGCCCTCGGCCCGGTACGCCGTCGTTGCCGTCTTC
ATCCTCTTCGCCTTCTACGCCTTCAACCGCAGCTCTCGCGAAATCTATGTTAACACTTCCTCCACTTCCATCATA
CGTCACCGAGTTCCTGTTCAACTCGAGAAACCACTGCAGCCGCCGTCTCCGCCGTCGCCGCCTACTATTTACCCC
GACCAATCCTCCGCCGACGGCACGAACCACCCCATCGACAAGCTAATATTCGATGCCCAGCGTTCCTTCGCCGGA
CTGCTCTCCTCTGAGTCAAAGTCGCTGGAAGACGCCGCTCAGGCGTACCGAAGACGCCGCGGCCGCCACCCCCCC
CCGGGTTTCGACAAGTGGTACGAGTTTGCTCGCTCCCGCAATGCCGTCATCGTCGAGGACTTCTTCGACCAGATC
TACCATGACCTCGAGCCCTTCTGGGGAATGGACCCCCTGAGCATGCGCCGTCGGGCGAGCCAATTCGAGATGACC
ATCAATGTCCGCAACGGTAATGCATCGGCGGTCTCGGATTGGTTCTGGACCAAGATATGGCTGGGGATGATCAAG
GAGATTGAAAAGTACCTCCCCGACATGGACATTGCCCTCAACGCAATGGACGAGCCTCGCATTGTCGCTACTTGG
GAGAACGTCAACAAGCACGTCAAGAAGGCGGCCGTAACCCGACGTCGGCCCAGGGCCCGGTCAGTCGTGTCCGAT
TTCCAGAAACTGCCAGGCCCAAACAAGGGCGATTTGGCACCCAAGGTCCCTGAAATCAAGTGGGATGAGACGGAA
CCGTACTGGCTCATCGCCCGCCGCGGCTGCTCCCCGAATAGCCTCGCTCGTAAGGCACCCCTGCAGACGTCTTTT
GCCGAGCCTCCCGCCATCAGCAACGACTACGCCGTTCAACACCTCCACCAGGGCTACGTGTCAAACTACAGCAAG
TCCAATGAAGTCTGTCATCAACCCGACCTGCAGGGCCTGCAGGGCCTACTCATCAAACCCATCAGCACCAAGGCG
ACCGACGTCCTGTTTCCCATGTTCGGGGGCTCCAAGCTGACGGTCAACAACGAGATTCTTCTGCCCGCCCCCATG
TACTGGAACGAGGAGGAGCGCTTCACCGGCGGCCAGGACCACGGCGATCCCTGGGCGGAAAAGGCCGACCAGGTC
ATCTGGCGCGGCGTTGCCACCGGAGGCAGAAACGAGGACGACAACTGGAGGGGTTTTCAGCGCCATCGCTTCGTG
GCCATGAATAACGGCACCAAGATCTCCCTGATCGAGTCGGGCAAGGAGAAGCCGGAGAATTTTGCGCTGGCCGAG
GAGCGCTACAACGTGAGCGCGCAGAGGGAACACAAACTCGGCAAATGGATTTCCGACGTCTCTGATGTGGCCTTC
ATCGACCTCTTTTGTGACCCTCCACAGGACGGCTGGTGCAATTACACCGACTTTTACTTCGAACCCAAGCCCGCG
CTCAACATGGCGACCCAGTTCGACTCGAAATATCTGCCCGACATTGACGGTAACTCCTTCTCGGGCCGCTACCTC
GGCTTCTTGCGGTCGAGCTCGCTGCCCATTAAGGCGTCCGTCTGGCGCGAGTGGCACGACAGCCGCCTGGTTCCG
TGGAAGCACTTTGTGCCCATGGACAACCGCTTTTCCGACTATTACGGCATTCTCGACTACTTCATCGGCTCCAAC
GACCGTGACGGCCACGACGAGGCCGCCGAGAGGATTGCCTCGGACGGAAAGGAGTGGGCGGAGCGGGTGTTGCGC
AAGGAGGACATGCTGATCTACGTCTTGCGGCTGCTTCTGGAGTATGCTCGCGTCGTCGACAAGAGGAGAGAGTCG
ATGGGCTGGGTCGACGACATACTCAAGGACCCGTCCCTGGAGCAGCCGCAGCCTGGACGGTGGTGGTTGCTGTCG
Transcript >Ophio5|4222
ATGGGCAACAAACTCTTATCCCCGACAACGTTCCGCCGACGGCCCTCGGCCCGGTACGCCGTCGTTGCCGTCTTC
ATCCTCTTCGCCTTCTACGCCTTCAACCGCAGCTCTCGCGAAATCTATGTTAACACTTCCTCCACTTCCATCATA
CGTCACCGAGTTCCTGTTCAACTCGAGAAACCACTGCAGCCGCCGTCTCCGCCGTCGCCGCCTACTATTTACCCC
GACCAATCCTCCGCCGACGGCACGAACCACCCCATCGACAAGCTAATATTCGATGCCCAGCGTTCCTTCGCCGGA
CTGCTCTCCTCTGAGTCAAAGTCGCTGGAAGACGCCGCTCAGGCGTACCGAAGACGCCGCGGCCGCCACCCCCCC
CCGGGTTTCGACAAGTGGTACGAGTTTGCTCGCTCCCGCAATGCCGTCATCGTCGAGGACTTCTTCGACCAGATC
TACCATGACCTCGAGCCCTTCTGGGGAATGGACCCCCTGAGCATGCGCCGTCGGGCGAGCCAATTCGAGATGACC
ATCAATGTCCGCAACGGTAATGCATCGGCGGTCTCGGATTGGTTCTGGACCAAGATATGGCTGGGGATGATCAAG
GAGATTGAAAAGTACCTCCCCGACATGGACATTGCCCTCAACGCAATGGACGAGCCTCGCATTGTCGCTACTTGG
GAGAACGTCAACAAGCACGTCAAGAAGGCGGCCGTAACCCGACGTCGGCCCAGGGCCCGGTCAGTCGTGTCCGAT
TTCCAGAAACTGCCAGGCCCAAACAAGGGCGATTTGGCACCCAAGGTCCCTGAAATCAAGTGGGATGAGACGGAA
CCGTACTGGCTCATCGCCCGCCGCGGCTGCTCCCCGAATAGCCTCGCTCGTAAGGCACCCCTGCAGACGTCTTTT
GCCGAGCCTCCCGCCATCAGCAACGACTACGCCGTTCAACACCTCCACCAGGGCTACGTGTCAAACTACAGCAAG
TCCAATGAAGTCTGTCATCAACCCGACCTGCAGGGCCTGCAGGGCCTACTCATCAAACCCATCAGCACCAAGGCG
ACCGACGTCCTGTTTCCCATGTTCGGGGGCTCCAAGCTGACGGTCAACAACGAGATTCTTCTGCCCGCCCCCATG
TACTGGAACGAGGAGGAGCGCTTCACCGGCGGCCAGGACCACGGCGATCCCTGGGCGGAAAAGGCCGACCAGGTC
ATCTGGCGCGGCGTTGCCACCGGAGGCAGAAACGAGGACGACAACTGGAGGGGTTTTCAGCGCCATCGCTTCGTG
GCCATGAATAACGGCACCAAGATCTCCCTGATCGAGTCGGGCAAGGAGAAGCCGGAGAATTTTGCGCTGGCCGAG
GAGCGCTACAACGTGAGCGCGCAGAGGGAACACAAACTCGGCAAATGGATTTCCGACGTCTCTGATGTGGCCTTC
ATCGACCTCTTTTGTGACCCTCCACAGGACGGCTGGTGCAATTACACCGACTTTTACTTCGAACCCAAGCCCGCG
CTCAACATGGCGACCCAGTTCGACTCGAAATATCTGCCCGACATTGACGGTAACTCCTTCTCGGGCCGCTACCTC
GGCTTCTTGCGGTCGAGCTCGCTGCCCATTAAGGCGTCCGTCTGGCGCGAGTGGCACGACAGCCGCCTGGTTCCG
TGGAAGCACTTTGTGCCCATGGACAACCGCTTTTCCGACTATTACGGCATTCTCGACTACTTCATCGGCTCCAAC
GACCGTGACGGCCACGACGAGGCCGCCGAGAGGATTGCCTCGGACGGAAAGGAGTGGGCGGAGCGGGTGTTGCGC
AAGGAGGACATGCTGATCTACGTCTTGCGGCTGCTTCTGGAGTATGCTCGCGTCGTCGACAAGAGGAGAGAGTCG
ATGGGCTGGGTCGACGACATACTCAAGGACCCGTCCCTGGAGCAGCCGCAGCCTGGACGGTGGTGGTTGCTGTCG
TGA
Gene >Ophio5|4222
ATGGGCAACAAACTCTTATCCCCGACAACGTTCCGCCGACGGCCCTCGGCCCGGTACGCCGTCGTTGCCGTCTTC
ATCCTCTTCGCCTTCTACGCCTTCAACCGCAGCTCTCGCGAAATCTATGTTAACACTTCCTCCACTTCCATCATA
CGTCACCGAGTTCCTGTTCAACTCGAGAAACCACTGCAGCCGCCGTCTCCGCCGTCGCCGCCTACTATTTACCCC
GACCAATCCTCCGCCGACGGCACGAACCACCCCATCGACAAGCTAATATTCGATGCCCAGCGTTCCTTCGCCGGA
CTGCTCTCCTCTGAGTCAAAGTCGCTGGAAGACGCCGCTCAGGCGTACCGAAGACGCCGCGGCCGCCACCCCCCC
CCGGGTTTCGACAAGTGGTACGAGTTTGCTCGCTCCCGCAATGCCGTCATCGTCGAGGACTTCTTCGACCAGATC
TACCATGACCTCGAGCCCTTCTGGGGAATGGACCCCCTGAGCATGCGCCGTCGGGCGAGCCAATTCGAGATGACC
ATCAATGTCCGCAACGGTAATGCATCGGCGGTCTCGGATTGGTTCTGGACCAAGATATGGCTGGGGATGATCAAG
GAGATTGAAAAGTACCTCCCCGACATGGACATTGCCCTCAACGCAATGGACGAGCCTCGCATTGTCGCTACTTGG
GAGAACGTCAACAAGCACGTCAAGAAGGCGGCCGTAACCCGACGTCGGCCCAGGGCCCGGTCAGTCGTGTCCGAT
TTCCAGAAACTGCCAGGCCCAAACAAGGGCGATTTGGCACCCAAGGTCCCTGAAATCAAGTGGGATGAGACGGGT
AAGTCGACGGAAAACAAGAAGATCAGACGCTAAGGCTAACAAAATCAAAGAACCGTACTGGCTCATCGCCCGCCG
CGGCTGCTCCCCGAATAGCCTCGCTCGTAAGGCACCCCTGCAGACGTCTTTTGCCGAGCCTCCCGCCATCAGCAA
CGACTACGCCGTTCAACACCTCCACCAGGGCTACGTGTCAAACTACAGCAAGTCCAATGAAGTCTGTCATCAACC
CGACCTGCAGGGCCTGCAGGGCCTACTCATCAAACCCATCAGCACCAAGGCGACCGACGTCCTGTTTCCCATGTT
CGGGGGCTCCAAGCTGACGGTCAACAACGAGATTCTTCTGCCCGCCCCCATGTACTGGAACGAGGAGGAGCGCTT
CACCGGCGGCCAGGACCACGGCGATCCCTGGGCGGAAAAGGCCGACCAGGTCATCTGGCGCGGCGTTGCCACCGG
AGGCAGAAACGAGGACGACAACTGGAGGGGTTTTCAGCGCCATCGCTTCGTGGCCATGAATAACGGCACCAAGAT
CTCCCTGATCGAGTCGGGCAAGGAGAAGCCGGAGAATTTTGCGCTGGCCGAGGAGCGCTACAACGTGAGCGCGCA
GAGGGAACACAAACTCGGCAAATGGATTTCCGACGTCTCTGATGTGGCCTTCATCGACCTCTTTTGTGACCCTCC
ACAGGACGGCTGGTGCAATTACACCGACTTTTACTTCGAACCCAAGCCCGCGCTCAACATGGCGACCCAGTTCGA
CTCGAAATATCTGCCCGACATTGACGGTAACTCCTTCTCGGGCCGCTACCTCGGCTTCTTGCGGTCGAGCTCGCT
GCCCATTAAGGCGTCCGTCTGGCGCGAGTGGCACGACAGCCGCCTGGTTCCGTGGAAGCACTTTGTGCCCATGGA
CAACCGCTTTTCCGACTATTACGGCATTCTCGACTACTTCATCGGCTCCAACGACCGTGACGGCCACGACGAGGC
CGCCGAGAGGATTGCCTCGGACGGAAAGGAGTGGGCGGAGCGGGTGTTGCGCAAGGAGGACATGCTGATCTACGT
CTTGCGGCTGCTTCTGGAGTATGCTCGCGTCGTCGACAAGAGGAGAGAGTCGATGGGCTGGGTCGACGACATACT
CAAGGACCCGTCCCTGGAGCAGCCGCAGCCTGGACGGTGGTGGTTGCTGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail