Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|422
Gene name
Locationscaffold_11:45820..46756
Strand-
Gene length (bp)936
Transcript length (bp)873
Coding sequence length (bp)870
Protein length (aa) 290

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20434 BD-FAE BD-FAE 9.4E-09 43 147
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 3.0E-06 49 156

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A5DNX8|KFA_PICGU Kynurenine formamidase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=BNA7 PE=3 SV=2 19 271 9.0E-27
sp|Q59ZV4|KFA_CANAL Kynurenine formamidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BNA7 PE=3 SV=1 24 277 9.0E-15
sp|Q6BT11|KFA_DEBHA Kynurenine formamidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BNA7 PE=3 SV=2 23 199 1.0E-14
sp|Q759T3|KFA_ASHGO Kynurenine formamidase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BNA7 PE=3 SV=1 49 284 4.0E-13
sp|A3GGU3|KFA_PICST Kynurenine formamidase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=BNA7 PE=3 SV=2 20 198 5.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A5DNX8|KFA_PICGU Kynurenine formamidase OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=BNA7 PE=3 SV=2 19 271 9.0E-27
sp|Q59ZV4|KFA_CANAL Kynurenine formamidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BNA7 PE=3 SV=1 24 277 9.0E-15
sp|Q6BT11|KFA_DEBHA Kynurenine formamidase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BNA7 PE=3 SV=2 23 199 1.0E-14
sp|Q759T3|KFA_ASHGO Kynurenine formamidase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BNA7 PE=3 SV=1 49 284 4.0E-13
sp|A3GGU3|KFA_PICST Kynurenine formamidase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=BNA7 PE=3 SV=2 20 198 5.0E-12
sp|A7TJ85|KFA_VANPO Kynurenine formamidase OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=BNA7 PE=3 SV=1 49 287 2.0E-10
sp|Q04066|KFA_YEAST Kynurenine formamidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BNA7 PE=1 SV=1 49 275 3.0E-10
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|422
MRPSLQLFGLVPFVSLAATSFNLLSYGPHPRQVVGVWDDGQANHVSPWIVFIHGGAWRNQQNSFRDFEPSVNNMM
ASGLLPPGTTLASIDYRLSPCAIPGANPCPAPVQHPDHILDVRAALQMLAQQRGLKSNYVLIGHSAGATLSFQLL
MGEAALQGRPLIRAPLPTTVIGIAGIYDMRGINHRFGGRYTDFLTQAFGWDQSVWDRASPVRFAGSFSERLPPPG
RVLLARSPGDSLVDGVELDTMARKLAGDGVALSVVETLMGEHNAVWEDGRQIPGLVAQVLPRHQK
Coding >Ophio5|422
ATGAGGCCCAGCTTGCAACTCTTTGGCCTGGTGCCGTTTGTCTCACTTGCGGCAACTAGCTTCAATCTGCTATCG
TACGGCCCGCATCCTCGACAAGTCGTGGGCGTGTGGGATGATGGCCAGGCCAACCATGTCTCACCATGGATCGTA
TTTATCCATGGCGGTGCCTGGCGCAATCAACAAAACTCATTTCGAGACTTCGAGCCATCCGTCAATAACATGATG
GCATCCGGTCTCCTCCCCCCGGGCACCACCTTGGCCTCCATCGATTACCGCCTCTCCCCTTGCGCCATACCGGGA
GCCAACCCTTGCCCGGCGCCAGTCCAGCACCCAGACCACATACTGGACGTCCGTGCGGCGCTACAGATGCTCGCC
CAGCAGCGTGGGCTCAAAAGCAACTACGTCCTCATCGGACACTCGGCCGGAGCGACGCTCTCATTCCAGCTGTTG
ATGGGCGAGGCGGCGCTCCAAGGTCGCCCCTTGATCAGGGCTCCGCTTCCCACGACCGTCATCGGCATCGCGGGC
ATCTACGACATGAGGGGCATCAACCATCGGTTTGGCGGCCGGTACACCGACTTCCTCACTCAGGCCTTCGGCTGG
GATCAGAGCGTCTGGGACAGGGCTTCGCCGGTCCGTTTCGCGGGGAGCTTTAGCGAGCGGTTGCCTCCGCCTGGG
AGGGTGCTTCTGGCCCGGTCTCCTGGGGATAGCCTTGTTGATGGCGTCGAGTTGGACACCATGGCCCGGAAGCTC
GCTGGGGATGGAGTTGCGCTGTCGGTGGTGGAAACGCTCATGGGCGAGCATAACGCTGTGTGGGAAGACGGCCGA
CAGATACCTGGTCTCGTGGCGCAAGTACTGCCTCGGCATCAAAAG
Transcript >Ophio5|422
ATGAGGCCCAGCTTGCAACTCTTTGGCCTGGTGCCGTTTGTCTCACTTGCGGCAACTAGCTTCAATCTGCTATCG
TACGGCCCGCATCCTCGACAAGTCGTGGGCGTGTGGGATGATGGCCAGGCCAACCATGTCTCACCATGGATCGTA
TTTATCCATGGCGGTGCCTGGCGCAATCAACAAAACTCATTTCGAGACTTCGAGCCATCCGTCAATAACATGATG
GCATCCGGTCTCCTCCCCCCGGGCACCACCTTGGCCTCCATCGATTACCGCCTCTCCCCTTGCGCCATACCGGGA
GCCAACCCTTGCCCGGCGCCAGTCCAGCACCCAGACCACATACTGGACGTCCGTGCGGCGCTACAGATGCTCGCC
CAGCAGCGTGGGCTCAAAAGCAACTACGTCCTCATCGGACACTCGGCCGGAGCGACGCTCTCATTCCAGCTGTTG
ATGGGCGAGGCGGCGCTCCAAGGTCGCCCCTTGATCAGGGCTCCGCTTCCCACGACCGTCATCGGCATCGCGGGC
ATCTACGACATGAGGGGCATCAACCATCGGTTTGGCGGCCGGTACACCGACTTCCTCACTCAGGCCTTCGGCTGG
GATCAGAGCGTCTGGGACAGGGCTTCGCCGGTCCGTTTCGCGGGGAGCTTTAGCGAGCGGTTGCCTCCGCCTGGG
AGGGTGCTTCTGGCCCGGTCTCCTGGGGATAGCCTTGTTGATGGCGTCGAGTTGGACACCATGGCCCGGAAGCTC
GCTGGGGATGGAGTTGCGCTGTCGGTGGTGGAAACGCTCATGGGCGAGCATAACGCTGTGTGGGAAGACGGCCGA
CAGATACCTGGTCTCGTGGCGCAAGTACTGCCTCGGCATCAAAAGTGA
Gene >Ophio5|422
ATGAGGCCCAGCTTGCAACTCTTTGGCCTGGTGCCGTTTGTCTCACTTGCGGCAACTAGCTTCAATCTGCTATCG
TACGGCCCGCATCCTCGACAAGTCGTGGGCGTGTGGGATGATGGCCAGGCCAACCATGTCTCACCATGGATCGTG
TAAGCCCCCCCCCCCCCTCGGTTTAGCCATCTCTCTCGCGACTGACAACGGACATGATCAAGATTTATCCATGGC
GGTGCCTGGCGCAATCAACAAAACTCATTTCGAGACTTCGAGCCATCCGTCAATAACATGATGGCATCCGGTCTC
CTCCCCCCGGGCACCACCTTGGCCTCCATCGATTACCGCCTCTCCCCTTGCGCCATACCGGGAGCCAACCCTTGC
CCGGCGCCAGTCCAGCACCCAGACCACATACTGGACGTCCGTGCGGCGCTACAGATGCTCGCCCAGCAGCGTGGG
CTCAAAAGCAACTACGTCCTCATCGGACACTCGGCCGGAGCGACGCTCTCATTCCAGCTGTTGATGGGCGAGGCG
GCGCTCCAAGGTCGCCCCTTGATCAGGGCTCCGCTTCCCACGACCGTCATCGGCATCGCGGGCATCTACGACATG
AGGGGCATCAACCATCGGTTTGGCGGCCGGTACACCGACTTCCTCACTCAGGCCTTCGGCTGGGATCAGAGCGTC
TGGGACAGGGCTTCGCCGGTCCGTTTCGCGGGGAGCTTTAGCGAGCGGTTGCCTCCGCCTGGGAGGGTGCTTCTG
GCCCGGTCTCCTGGGGATAGCCTTGTTGATGGCGTCGAGTTGGACACCATGGCCCGGAAGCTCGCTGGGGATGGA
GTTGCGCTGTCGGTGGTGGAAACGCTCATGGGCGAGCATAACGCTGTGTGGGAAGACGGCCGACAGATACCTGGT
CTCGTGGCGCAAGTACTGCCTCGGCATCAAAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail