Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|420
Gene name
Locationscaffold_11:43186..44712
Strand+
Gene length (bp)1526
Transcript length (bp)1416
Coding sequence length (bp)1413
Protein length (aa) 471

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.5E-27 88 397

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 59 470 4.0E-60
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 7 470 1.0E-57
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 74 455 5.0E-21
sp|Q6P2X9|MOT12_XENTR Monocarboxylate transporter 12 OS=Xenopus tropicalis GN=slc16a12 PE=2 SV=1 66 463 2.0E-20
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 74 463 2.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08268|MCH4_YEAST Probable transporter MCH4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH4 PE=1 SV=1 59 470 4.0E-60
sp|Q08777|MCH5_YEAST Riboflavin transporter MCH5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH5 PE=1 SV=2 7 470 1.0E-57
sp|P53918|ESBP6_YEAST Uncharacterized transporter ESBP6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ESBP6 PE=1 SV=1 74 455 5.0E-21
sp|Q6P2X9|MOT12_XENTR Monocarboxylate transporter 12 OS=Xenopus tropicalis GN=slc16a12 PE=2 SV=1 66 463 2.0E-20
sp|Q6GM59|MOT12_XENLA Monocarboxylate transporter 12 OS=Xenopus laevis GN=slc16a12 PE=2 SV=1 74 463 2.0E-20
sp|Q6ZSM3|MOT12_HUMAN Monocarboxylate transporter 12 OS=Homo sapiens GN=SLC16A12 PE=1 SV=2 63 463 7.0E-20
sp|Q8BGC3|MOT12_MOUSE Monocarboxylate transporter 12 OS=Mus musculus GN=Slc16a12 PE=2 SV=1 74 463 7.0E-20
sp|P36032|MCH2_YEAST Probable transporter MCH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCH2 PE=1 SV=2 34 448 4.0E-19
sp|A1L1W9|MOT10_DANRE Monocarboxylate transporter 10 OS=Danio rerio GN=slc16a10 PE=2 SV=1 63 467 5.0E-19
sp|Q8CE94|MOT13_MOUSE Monocarboxylate transporter 13 OS=Mus musculus GN=Slc16a13 PE=2 SV=1 74 435 9.0E-19
sp|Q17QR6|MOT13_BOVIN Monocarboxylate transporter 13 OS=Bos taurus GN=SLC16A13 PE=2 SV=1 74 435 1.0E-17
sp|Q66HE2|MOT13_RAT Monocarboxylate transporter 13 OS=Rattus norvegicus GN=Slc16a13 PE=2 SV=1 74 435 1.0E-17
sp|Q7RTY0|MOT13_HUMAN Monocarboxylate transporter 13 OS=Homo sapiens GN=SLC16A13 PE=2 SV=1 74 435 2.0E-17
sp|Q503M4|MT12B_DANRE Monocarboxylate transporter 12-B OS=Danio rerio GN=slc16a12b PE=2 SV=1 74 435 6.0E-15
sp|Q8K1P8|MOT8_RAT Monocarboxylate transporter 8 OS=Rattus norvegicus GN=SLC16A2 PE=1 SV=1 52 456 1.0E-12
sp|P36021|MOT8_HUMAN Monocarboxylate transporter 8 OS=Homo sapiens GN=SLC16A2 PE=1 SV=2 52 456 3.0E-12
sp|O15427|MOT4_HUMAN Monocarboxylate transporter 4 OS=Homo sapiens GN=SLC16A3 PE=1 SV=1 69 433 3.0E-12
sp|Q91Y77|MOT10_RAT Monocarboxylate transporter 10 OS=Rattus norvegicus GN=Slc16a10 PE=1 SV=1 29 443 1.0E-11
sp|Q90632|MOT3_CHICK Monocarboxylate transporter 3 OS=Gallus gallus GN=SLC16A3 PE=2 SV=2 63 433 1.0E-11
sp|O70324|MOT8_MOUSE Monocarboxylate transporter 8 OS=Mus musculus GN=Slc16a2 PE=1 SV=2 52 456 2.0E-11
sp|O70451|MOT2_MOUSE Monocarboxylate transporter 2 OS=Mus musculus GN=Slc16a7 PE=1 SV=1 62 439 4.0E-10
sp|O35910|MOT4_RAT Monocarboxylate transporter 4 OS=Rattus norvegicus GN=Slc16a3 PE=1 SV=1 69 433 6.0E-10
sp|P57787|MOT4_MOUSE Monocarboxylate transporter 4 OS=Mus musculus GN=Slc16a3 PE=1 SV=1 69 433 7.0E-10
sp|Q8TF71|MOT10_HUMAN Monocarboxylate transporter 10 OS=Homo sapiens GN=SLC16A10 PE=1 SV=1 54 455 6.0E-09
sp|P53988|MOT2_MESAU Monocarboxylate transporter 2 OS=Mesocricetus auratus GN=SLC16A7 PE=1 SV=1 75 432 1.0E-08
sp|P57788|MOT4_CHICK Monocarboxylate transporter 4 OS=Gallus gallus GN=SLC16A3 PE=2 SV=1 69 432 3.0E-08
sp|Q3U9N9|MOT10_MOUSE Monocarboxylate transporter 10 OS=Mus musculus GN=Slc16a10 PE=1 SV=1 37 435 1.0E-07
sp|Q63344|MOT2_RAT Monocarboxylate transporter 2 OS=Rattus norvegicus GN=Slc16a7 PE=1 SV=1 75 439 3.0E-07
sp|O15403|MOT7_HUMAN Monocarboxylate transporter 7 OS=Homo sapiens GN=SLC16A6 PE=1 SV=2 74 265 4.0E-07
sp|B1AT66|MOT7_MOUSE Monocarboxylate transporter 7 OS=Mus musculus GN=Slc16a6 PE=1 SV=1 74 265 5.0E-07
sp|P53985|MOT1_HUMAN Monocarboxylate transporter 1 OS=Homo sapiens GN=SLC16A1 PE=1 SV=3 69 271 1.0E-06
sp|O60669|MOT2_HUMAN Monocarboxylate transporter 2 OS=Homo sapiens GN=SLC16A7 PE=1 SV=2 75 446 1.0E-06
sp|Q3MHW6|MOT1_BOVIN Monocarboxylate transporter 1 OS=Bos taurus GN=SLC16A1 PE=2 SV=2 69 269 2.0E-06
sp|Q03064|MOT1_CRILO Monocarboxylate transporter 1 OS=Cricetulus longicaudatus GN=SLC16A1 PE=1 SV=1 69 285 3.0E-06
sp|Q5ZJU0|MOT9_CHICK Monocarboxylate transporter 9 OS=Gallus gallus GN=SLC16A9 PE=2 SV=1 74 288 4.0E-06
sp|P39352|YJHB_ECOLI Putative metabolite transport protein YjhB OS=Escherichia coli (strain K12) GN=yjhB PE=1 SV=2 136 444 6.0E-06
sp|O35308|MOT3_MOUSE Monocarboxylate transporter 3 OS=Mus musculus GN=Slc16a8 PE=2 SV=2 75 433 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 83 105 22
2 120 142 22
3 154 176 22
4 181 203 22
5 210 232 22
6 242 264 22
7 285 307 22
8 318 340 22
9 347 369 22
10 374 396 22
11 409 431 22
12 436 458 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|420
MQTTTANPQMTQVTATTLTAANSTISLSSVEKARQLEYHHKHQEPPFLSSSDDEDVEASSPPSSAKAPGPDGFPD
GGFEAWLVVFGGWCALFCTFGLINCVGVFQQYYVANPLSQYGASAVSWIMSVQIFVMIFCGTIFGRIFDNYGPKW
MLRLGTVAYVFGLMMVSLSTQYYQFFLAQSIVSAAGSSAVFNCCMSSLVTWFARRRAAAFGIMVSGSSVGGVVLP
IMMTQLIDRIGFPWMMRVMAFIFLGLLIIACVTVKSRLPPRPRPFRFMEYVDNLKDIRMAVTVAGLFFFMWGMFL
PFNYALVQAQAAGTSPALIPYLLPILNAVSIIGRILPGIVADKIGRFNVMIIISFLSAIFCLAVWTPVNNTVGII
VFMVIFGFSSGGYIGLAPTLIAQISDITQIGTRVGTAFAIQSFGALTGSPIGGALVSAQGGRYLGLQLFCGFAML
IGCFIFVAARYIQAGFKIVKV
Coding >Ophio5|420
ATGCAGACAACAACAGCCAACCCGCAAATGACACAAGTGACGGCTACGACGCTCACAGCCGCAAACTCAACCATC
TCCCTGTCATCGGTGGAAAAAGCTCGTCAGCTTGAATACCACCATAAACATCAAGAGCCACCTTTTCTCTCTTCC
TCGGATGACGAGGATGTCGAAGCTTCGTCGCCGCCTTCTTCGGCCAAGGCACCTGGGCCTGATGGCTTTCCGGAT
GGTGGATTCGAGGCTTGGCTTGTTGTTTTTGGGGGGTGGTGTGCCTTGTTTTGTACCTTTGGCTTGATTAACTGT
GTGGGTGTCTTTCAGCAGTATTATGTGGCCAATCCGTTGAGTCAGTATGGGGCTTCGGCGGTTAGTTGGATCATG
TCGGTGCAGATTTTCGTCATGATCTTTTGCGGGACCATCTTTGGTCGCATCTTCGACAACTACGGCCCCAAGTGG
ATGCTCCGTCTCGGAACCGTCGCCTACGTCTTCGGCTTGATGATGGTTTCCCTTTCGACGCAATACTACCAATTC
TTCCTCGCCCAGTCCATCGTCTCCGCCGCCGGCTCCAGCGCCGTCTTCAACTGCTGCATGTCGTCGCTCGTTACC
TGGTTTGCGCGCCGTCGTGCTGCTGCTTTTGGAATCATGGTCTCTGGTTCTTCGGTTGGAGGCGTCGTCTTGCCC
ATTATGATGACGCAGCTCATCGATCGTATCGGCTTCCCCTGGATGATGCGTGTCATGGCCTTTATCTTTCTTGGA
CTGCTGATTATTGCTTGCGTTACCGTCAAGTCGCGTCTGCCGCCGCGCCCGAGGCCCTTCCGTTTCATGGAATAT
GTCGACAATCTCAAGGACATTCGCATGGCTGTTACCGTTGCTGGTCTGTTCTTCTTCATGTGGGGCATGTTCCTG
CCTTTCAACTATGCCCTGGTGCAGGCTCAGGCTGCTGGCACGTCTCCGGCTCTGATTCCCTACTTGCTACCTATC
CTCAACGCCGTTAGCATCATCGGCCGCATTCTTCCCGGCATCGTCGCCGACAAAATCGGCCGATTCAACGTCATG
ATCATCATCAGCTTTCTTTCTGCCATCTTCTGTTTGGCCGTCTGGACCCCCGTCAACAATACGGTCGGCATCATC
GTCTTCATGGTCATTTTTGGCTTCTCCTCTGGCGGCTACATCGGTCTCGCCCCGACGCTCATTGCTCAGATATCA
GATATTACGCAGATCGGCACTCGCGTTGGCACCGCCTTTGCCATCCAGTCCTTTGGCGCCCTGACTGGCAGCCCC
ATCGGTGGTGCTCTCGTTTCCGCGCAGGGTGGCAGATATCTGGGCCTGCAGCTATTCTGTGGCTTCGCCATGCTC
ATCGGCTGCTTCATCTTTGTCGCTGCCAGGTATATCCAGGCTGGCTTCAAGATTGTCAAGGTG
Transcript >Ophio5|420
ATGCAGACAACAACAGCCAACCCGCAAATGACACAAGTGACGGCTACGACGCTCACAGCCGCAAACTCAACCATC
TCCCTGTCATCGGTGGAAAAAGCTCGTCAGCTTGAATACCACCATAAACATCAAGAGCCACCTTTTCTCTCTTCC
TCGGATGACGAGGATGTCGAAGCTTCGTCGCCGCCTTCTTCGGCCAAGGCACCTGGGCCTGATGGCTTTCCGGAT
GGTGGATTCGAGGCTTGGCTTGTTGTTTTTGGGGGGTGGTGTGCCTTGTTTTGTACCTTTGGCTTGATTAACTGT
GTGGGTGTCTTTCAGCAGTATTATGTGGCCAATCCGTTGAGTCAGTATGGGGCTTCGGCGGTTAGTTGGATCATG
TCGGTGCAGATTTTCGTCATGATCTTTTGCGGGACCATCTTTGGTCGCATCTTCGACAACTACGGCCCCAAGTGG
ATGCTCCGTCTCGGAACCGTCGCCTACGTCTTCGGCTTGATGATGGTTTCCCTTTCGACGCAATACTACCAATTC
TTCCTCGCCCAGTCCATCGTCTCCGCCGCCGGCTCCAGCGCCGTCTTCAACTGCTGCATGTCGTCGCTCGTTACC
TGGTTTGCGCGCCGTCGTGCTGCTGCTTTTGGAATCATGGTCTCTGGTTCTTCGGTTGGAGGCGTCGTCTTGCCC
ATTATGATGACGCAGCTCATCGATCGTATCGGCTTCCCCTGGATGATGCGTGTCATGGCCTTTATCTTTCTTGGA
CTGCTGATTATTGCTTGCGTTACCGTCAAGTCGCGTCTGCCGCCGCGCCCGAGGCCCTTCCGTTTCATGGAATAT
GTCGACAATCTCAAGGACATTCGCATGGCTGTTACCGTTGCTGGTCTGTTCTTCTTCATGTGGGGCATGTTCCTG
CCTTTCAACTATGCCCTGGTGCAGGCTCAGGCTGCTGGCACGTCTCCGGCTCTGATTCCCTACTTGCTACCTATC
CTCAACGCCGTTAGCATCATCGGCCGCATTCTTCCCGGCATCGTCGCCGACAAAATCGGCCGATTCAACGTCATG
ATCATCATCAGCTTTCTTTCTGCCATCTTCTGTTTGGCCGTCTGGACCCCCGTCAACAATACGGTCGGCATCATC
GTCTTCATGGTCATTTTTGGCTTCTCCTCTGGCGGCTACATCGGTCTCGCCCCGACGCTCATTGCTCAGATATCA
GATATTACGCAGATCGGCACTCGCGTTGGCACCGCCTTTGCCATCCAGTCCTTTGGCGCCCTGACTGGCAGCCCC
ATCGGTGGTGCTCTCGTTTCCGCGCAGGGTGGCAGATATCTGGGCCTGCAGCTATTCTGTGGCTTCGCCATGCTC
ATCGGCTGCTTCATCTTTGTCGCTGCCAGGTATATCCAGGCTGGCTTCAAGATTGTCAAGGTGTAG
Gene >Ophio5|420
ATGCAGACAACAACAGCCAACCCGCAAATGACACAAGTGACGGCTACGACGCTCACAGCCGCAAACTCAACCATC
TCCCTGTCATCGGTGGAAAAAGCTCGTCAGCTTGAATACCACCATAAACATCAAGAGCCACCTTTTCTCTCTTCC
TCGGATGACGAGGATGTCGAAGCTTCGTCGCCGCCTTCTTCGGCCAAGGCACCTGGGCCTGATGGCTTTCCGGAT
GGTGGATTCGAGGCTTGGCTTGTTGTTTTTGGGGGGTGGTGTGCCTTGTTTTGTACCTTTGGCTTGATTAACTGT
GTGGGTGTCTTTCAGCAGTATTATGTGGCCAATCCGTTGAGTCAGTATGGGGCTTCGGCGGTTAGTTGGATCATG
TCGGTGCAGATTTTCGTCATGATCTTTTGCGGGACCATCGTGAGATTACCTCTCTTTTTTACCCTCCTTCTCCTG
CTAACTTGTCTCAACAGTTTGGTCGCATCTTCGACAACTACGGCCCCAAGTGGATGCTCCGTCTCGGAACCGTCG
CCTACGTCTTCGGCTTGATGATGGTTTCCCTTTCGACGCAATACTACCAATTCTTCCTCGCCCAGTCCATCGTCT
CCGCCGCCGGCTCCAGCGCCGTCTTCAACTGCTGCATGTCGTCGCTCGTTACCTGGTTTGCGCGCCGTCGTGCTG
CTGCTTTTGGAATCATGGTCTCTGGTTCTTCGGTTGGAGGCGTCGTCTTGCCCATTATGATGACGCAGCTCATCG
ATCGTATCGGCTTCCCCTGGATGATGCGTGTCATGGCCTTTATCTTTCTTGGACTGCTGATTATTGCTTGCGTTA
CCGTCAAGTCGCGTCTGCCGCCGCGCCCGAGGCCCTTCCGTTTCATGGAATATGTCGACAATCTCAAGGACATTC
GCATGGCTGTTACCGTTGCTGGTCTGTTCTTCTTCATGTGGGGCATGTTCCTGCCTTTCAACTATGCCCTGGTGC
AGGCTCAGGCTGCTGGCACGTCTCCGGCTCTGATTCCCTACTTGCTACCTATCCTCAACGCCGTTAGGTGAGTTG
TTTTCTACTCCTCCAGGCCGCATCTCGTGTCTAACCGGAAAACTCGCAGCATCATCGGCCGCATTCTTCCCGGCA
TCGTCGCCGACAAAATCGGCCGATTCAACGTCATGATCATCATCAGCTTTCTTTCTGCCATCTTCTGTTTGGCCG
TCTGGACCCCCGTCAACAATACGGTCGGCATCATCGTCTTCATGGTCATTTTTGGCTTCTCCTCTGGCGGCTACA
TCGGTCTCGCCCCGACGCTCATTGCTCAGATATCAGATATTACGCAGATCGGCACTCGCGTTGGCACCGCCTTTG
CCATCCAGTCCTTTGGCGCCCTGACTGGCAGCCCCATCGGTGGTGCTCTCGTTTCCGCGCAGGGTGGCAGATATC
TGGGCCTGCAGCTATTCTGTGGCTTCGCCATGCTCATCGGCTGCTTCATCTTTGTCGCTGCCAGGTATATCCAGG
CTGGCTTCAAGATTGTCAAGGTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail