Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4199
Gene name
Locationscaffold_33:51753..54682
Strand+
Gene length (bp)2929
Transcript length (bp)2700
Coding sequence length (bp)2697
Protein length (aa) 899

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08558 TRF Telomere repeat binding factor (TRF) 4.7E-21 104 323

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6E434|TRF1_SCHPO Telomeric DNA-binding factor trf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trf1 PE=1 SV=1 515 625 1.0E-27
sp|Q5AHJ5|TBF1_CANAL Transcription factor TBF1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TBF1 PE=1 SV=1 545 622 4.0E-22
sp|Q02457|TBF1_YEAST Protein TBF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TBF1 PE=1 SV=2 547 625 1.0E-17
sp|Q6E434|TRF1_SCHPO Telomeric DNA-binding factor trf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trf1 PE=1 SV=1 82 319 2.0E-09

GO

GO Term Description Terminal node
GO:0042803 protein homodimerization activity Yes
GO:0042162 telomeric DNA binding Yes
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0005515 protein binding No
GO:0043565 sequence-specific DNA binding No
GO:0003674 molecular_function No
GO:0046983 protein dimerization activity No
GO:0042802 identical protein binding No
GO:0003677 DNA binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4199
MAEPAQLEHVSAPYIKQEYDADVARLTGAKRPLEHDGRGEPEAKRSKTGEDSLEDGLALLVQNALSSVGDLVDQF
NAESGPVDAPPEAPRPTFSADPQAFIRDMSLHSLSNVALSLLHIYVQKPLQATVDLIRDAESEHGRCYRQLRHSF
EQLRLLYTTKPVMSAKEMDLRRTESRAVVELANLAQLGSWLFDGSAQALAEADDNFLALFSCQVADLPPGLTELY
IGIMIQRAVEGLVLKEPEKPAEELLGGLLMEGLEDKLKRQHQGVELTLADQNFIASVQCWKETLGGESREQAVST
ALRELHPFKCLLQSFVCHVKRRMRCESHWNGKFGVTLQLDDDDDDDDDEAEADDAALALDNADASCRVTRETAEV
ELDLDEISSLLEKETSSLVQNALAGQTEDEVSASDGAQADGGTASTNGKADLMTDYKELEALVAASTSHYVKTTL
NGLSPMPYQPTVPQSTAEAMAAQPPYTQQHHQALHPYYPSGPQPPAAEAQAPQQAAPGEDLPPNQTFPSAILYDK
ARQAALSKTTAHTRREGLHSTRRPWSQEEEKALMAGLDMVKGPHWSQILTLFGHSGTISDILKDRTQVQLKDKAR
NLKLFFLKTNSEMPYYLQAVTGELKTRAPTQAARKEAEVRAKQNSDEDQARLQGIMALAGGLQDPAPPPQAKVVN
PAHGAQGAQGAQGAQAAMQPAGLSSAHRPPPAQGGRAGGMVVQATTQQVLQAMPQAPPRPQSQFPRPTTGLQAAV
RPRLAPAPSQQPGGVGAGSEPSRPSASGARQPQTTKTQQVEAKAQAQAPQKAPPSPVPPTCPAAPPVAADLTQQQ
QQQQQQQQQAPPVPDAPSPASTPSSWTRQGMAQSSASSTTTPSAQTAESTQRDVDGAEAALLEGLQAVVAQTLA
Coding >Ophio5|4199
ATGGCCGAGCCGGCACAGCTTGAGCACGTCAGTGCGCCGTACATAAAGCAGGAATACGACGCCGACGTCGCCCGC
CTGACAGGCGCCAAACGGCCCCTCGAGCACGATGGACGAGGCGAACCCGAGGCGAAGCGGTCCAAGACGGGGGAG
GACTCTCTCGAGGATGGACTGGCGCTCCTCGTCCAAAACGCCCTATCCAGCGTGGGCGACCTGGTTGACCAGTTC
AATGCAGAGTCCGGCCCCGTCGACGCGCCCCCAGAAGCCCCACGACCTACCTTCTCTGCCGATCCGCAGGCCTTT
ATTCGCGACATGAGCCTGCATTCCCTGAGTAATGTGGCGCTGTCTTTGTTACACATTTACGTCCAGAAGCCGCTC
CAAGCGACCGTGGACTTGATCCGGGACGCCGAGTCCGAACATGGCCGGTGCTACAGGCAGCTGAGACACTCGTTT
GAGCAGCTGCGACTACTCTACACCACAAAGCCCGTCATGTCTGCCAAGGAGATGGACCTGCGCCGGACCGAATCG
CGAGCCGTGGTTGAGCTGGCCAACCTCGCCCAGCTCGGCTCCTGGCTGTTTGACGGCAGTGCTCAGGCGCTTGCC
GAGGCCGACGACAATTTTTTGGCACTGTTCAGCTGCCAGGTCGCCGACTTACCGCCCGGGCTGACAGAGCTCTAC
ATCGGCATCATGATCCAGAGAGCGGTCGAGGGTTTGGTGCTCAAGGAGCCCGAGAAGCCGGCCGAGGAATTGCTG
GGAGGGTTGTTGATGGAGGGGCTAGAGGACAAGCTCAAGCGGCAGCACCAAGGCGTCGAGCTGACGTTGGCCGAC
CAGAACTTCATCGCGTCGGTGCAATGCTGGAAAGAGACTCTGGGGGGCGAGTCGCGAGAGCAAGCGGTGTCGACG
GCGCTACGTGAGTTGCATCCTTTCAAGTGTCTGCTGCAATCCTTCGTCTGTCACGTCAAGAGGAGAATGCGGTGT
GAATCTCATTGGAACGGCAAATTTGGTGTGACTTTGCAGCTCGACGACGACGACGACGACGACGACGATGAGGCT
GAGGCCGACGATGCGGCGCTCGCCCTTGACAATGCCGATGCGTCTTGCCGCGTCACACGGGAGACGGCCGAGGTG
GAACTCGACTTGGACGAGATATCGTCTTTGTTGGAAAAGGAGACGAGCAGTCTCGTGCAGAATGCGCTGGCCGGT
CAGACGGAAGATGAAGTATCGGCCTCGGACGGGGCCCAGGCGGACGGCGGCACGGCATCGACCAACGGCAAGGCC
GACCTCATGACCGACTACAAGGAGCTGGAGGCGCTGGTTGCCGCGAGCACGTCCCATTACGTCAAGACGACGCTC
AACGGGCTCTCGCCGATGCCCTACCAGCCGACGGTGCCCCAGAGCACAGCCGAGGCCATGGCAGCCCAACCGCCT
TATACGCAGCAGCACCACCAGGCACTGCATCCCTACTACCCGAGCGGCCCGCAGCCCCCGGCGGCGGAGGCGCAG
GCCCCTCAACAGGCGGCGCCCGGCGAAGACCTGCCGCCCAACCAGACCTTCCCCAGCGCCATCCTCTACGACAAG
GCGCGGCAGGCAGCCCTGTCGAAGACGACGGCGCACACAAGGAGGGAGGGCCTCCACTCGACGCGGCGGCCGTGG
TCGCAGGAGGAGGAGAAGGCGTTGATGGCAGGGCTGGACATGGTCAAGGGTCCGCACTGGAGTCAGATCCTGACG
CTGTTTGGGCACAGCGGCACCATTTCGGACATTTTGAAGGACCGGACGCAGGTGCAGCTCAAGGACAAGGCGCGG
AACCTCAAGCTCTTCTTCCTCAAGACCAACTCGGAGATGCCCTACTACTTGCAAGCCGTCACTGGCGAGCTCAAG
ACGAGGGCGCCGACGCAGGCGGCGCGCAAGGAGGCCGAGGTCCGGGCCAAGCAGAACTCGGACGAGGACCAGGCG
AGGCTGCAGGGCATCATGGCCCTGGCCGGCGGGCTGCAGGACCCCGCCCCGCCGCCGCAGGCCAAGGTGGTCAAC
CCGGCTCATGGGGCTCAGGGGGCTCAGGGGGCTCAGGGGGCCCAGGCGGCGATGCAGCCGGCCGGCCTCTCGTCG
GCGCACAGGCCGCCACCGGCTCAGGGCGGCAGGGCCGGCGGTATGGTTGTACAGGCGACGACGCAGCAAGTGCTC
CAGGCCATGCCGCAGGCGCCCCCTCGGCCGCAGTCGCAGTTCCCGCGGCCGACGACGGGCTTGCAGGCCGCCGTC
CGCCCGAGGCTGGCTCCGGCCCCGAGTCAGCAGCCCGGCGGAGTCGGAGCCGGGTCCGAGCCATCGCGGCCGTCG
GCGTCGGGGGCACGACAGCCGCAGACGACAAAAACACAGCAGGTCGAGGCCAAAGCACAGGCTCAGGCGCCGCAA
AAAGCACCGCCCTCTCCAGTGCCGCCTACTTGTCCCGCTGCTCCTCCTGTTGCTGCGGACTTGACGCAGCAACAG
CAGCAGCAGCAGCAGCAGCAGCAGCAGGCTCCTCCTGTCCCAGACGCCCCTTCACCGGCGTCCACGCCGTCTAGT
TGGACACGACAAGGAATGGCACAGTCGTCTGCGTCGTCGACAACGACGCCATCGGCACAGACGGCAGAATCGACG
CAGCGCGACGTCGACGGCGCGGAGGCAGCATTGCTGGAAGGCCTCCAGGCTGTGGTGGCACAGACGTTGGCG
Transcript >Ophio5|4199
ATGGCCGAGCCGGCACAGCTTGAGCACGTCAGTGCGCCGTACATAAAGCAGGAATACGACGCCGACGTCGCCCGC
CTGACAGGCGCCAAACGGCCCCTCGAGCACGATGGACGAGGCGAACCCGAGGCGAAGCGGTCCAAGACGGGGGAG
GACTCTCTCGAGGATGGACTGGCGCTCCTCGTCCAAAACGCCCTATCCAGCGTGGGCGACCTGGTTGACCAGTTC
AATGCAGAGTCCGGCCCCGTCGACGCGCCCCCAGAAGCCCCACGACCTACCTTCTCTGCCGATCCGCAGGCCTTT
ATTCGCGACATGAGCCTGCATTCCCTGAGTAATGTGGCGCTGTCTTTGTTACACATTTACGTCCAGAAGCCGCTC
CAAGCGACCGTGGACTTGATCCGGGACGCCGAGTCCGAACATGGCCGGTGCTACAGGCAGCTGAGACACTCGTTT
GAGCAGCTGCGACTACTCTACACCACAAAGCCCGTCATGTCTGCCAAGGAGATGGACCTGCGCCGGACCGAATCG
CGAGCCGTGGTTGAGCTGGCCAACCTCGCCCAGCTCGGCTCCTGGCTGTTTGACGGCAGTGCTCAGGCGCTTGCC
GAGGCCGACGACAATTTTTTGGCACTGTTCAGCTGCCAGGTCGCCGACTTACCGCCCGGGCTGACAGAGCTCTAC
ATCGGCATCATGATCCAGAGAGCGGTCGAGGGTTTGGTGCTCAAGGAGCCCGAGAAGCCGGCCGAGGAATTGCTG
GGAGGGTTGTTGATGGAGGGGCTAGAGGACAAGCTCAAGCGGCAGCACCAAGGCGTCGAGCTGACGTTGGCCGAC
CAGAACTTCATCGCGTCGGTGCAATGCTGGAAAGAGACTCTGGGGGGCGAGTCGCGAGAGCAAGCGGTGTCGACG
GCGCTACGTGAGTTGCATCCTTTCAAGTGTCTGCTGCAATCCTTCGTCTGTCACGTCAAGAGGAGAATGCGGTGT
GAATCTCATTGGAACGGCAAATTTGGTGTGACTTTGCAGCTCGACGACGACGACGACGACGACGACGATGAGGCT
GAGGCCGACGATGCGGCGCTCGCCCTTGACAATGCCGATGCGTCTTGCCGCGTCACACGGGAGACGGCCGAGGTG
GAACTCGACTTGGACGAGATATCGTCTTTGTTGGAAAAGGAGACGAGCAGTCTCGTGCAGAATGCGCTGGCCGGT
CAGACGGAAGATGAAGTATCGGCCTCGGACGGGGCCCAGGCGGACGGCGGCACGGCATCGACCAACGGCAAGGCC
GACCTCATGACCGACTACAAGGAGCTGGAGGCGCTGGTTGCCGCGAGCACGTCCCATTACGTCAAGACGACGCTC
AACGGGCTCTCGCCGATGCCCTACCAGCCGACGGTGCCCCAGAGCACAGCCGAGGCCATGGCAGCCCAACCGCCT
TATACGCAGCAGCACCACCAGGCACTGCATCCCTACTACCCGAGCGGCCCGCAGCCCCCGGCGGCGGAGGCGCAG
GCCCCTCAACAGGCGGCGCCCGGCGAAGACCTGCCGCCCAACCAGACCTTCCCCAGCGCCATCCTCTACGACAAG
GCGCGGCAGGCAGCCCTGTCGAAGACGACGGCGCACACAAGGAGGGAGGGCCTCCACTCGACGCGGCGGCCGTGG
TCGCAGGAGGAGGAGAAGGCGTTGATGGCAGGGCTGGACATGGTCAAGGGTCCGCACTGGAGTCAGATCCTGACG
CTGTTTGGGCACAGCGGCACCATTTCGGACATTTTGAAGGACCGGACGCAGGTGCAGCTCAAGGACAAGGCGCGG
AACCTCAAGCTCTTCTTCCTCAAGACCAACTCGGAGATGCCCTACTACTTGCAAGCCGTCACTGGCGAGCTCAAG
ACGAGGGCGCCGACGCAGGCGGCGCGCAAGGAGGCCGAGGTCCGGGCCAAGCAGAACTCGGACGAGGACCAGGCG
AGGCTGCAGGGCATCATGGCCCTGGCCGGCGGGCTGCAGGACCCCGCCCCGCCGCCGCAGGCCAAGGTGGTCAAC
CCGGCTCATGGGGCTCAGGGGGCTCAGGGGGCTCAGGGGGCCCAGGCGGCGATGCAGCCGGCCGGCCTCTCGTCG
GCGCACAGGCCGCCACCGGCTCAGGGCGGCAGGGCCGGCGGTATGGTTGTACAGGCGACGACGCAGCAAGTGCTC
CAGGCCATGCCGCAGGCGCCCCCTCGGCCGCAGTCGCAGTTCCCGCGGCCGACGACGGGCTTGCAGGCCGCCGTC
CGCCCGAGGCTGGCTCCGGCCCCGAGTCAGCAGCCCGGCGGAGTCGGAGCCGGGTCCGAGCCATCGCGGCCGTCG
GCGTCGGGGGCACGACAGCCGCAGACGACAAAAACACAGCAGGTCGAGGCCAAAGCACAGGCTCAGGCGCCGCAA
AAAGCACCGCCCTCTCCAGTGCCGCCTACTTGTCCCGCTGCTCCTCCTGTTGCTGCGGACTTGACGCAGCAACAG
CAGCAGCAGCAGCAGCAGCAGCAGCAGGCTCCTCCTGTCCCAGACGCCCCTTCACCGGCGTCCACGCCGTCTAGT
TGGACACGACAAGGAATGGCACAGTCGTCTGCGTCGTCGACAACGACGCCATCGGCACAGACGGCAGAATCGACG
CAGCGCGACGTCGACGGCGCGGAGGCAGCATTGCTGGAAGGCCTCCAGGCTGTGGTGGCACAGACGTTGGCGTGA
Gene >Ophio5|4199
ATGGCCGAGCCGGCACAGCTTGAGCACGTCAGTGCGCCGTGTACGTGTCTTGCAGGGCCGCCTGCCTCTCGGCCC
TTTTTTCTCCCCAAAGAAGAGGCTGACGGAGGCACAGACATAAAGCAGGAATACGACGCCGACGTCGCCCGCCTG
ACAGGCGCCAAACGGCCCCTCGAGCACGATGGACGAGGCGAACCCGAGGCGAAGCGGTCCAAGACGGGGGAGGAC
TCTCTCGAGGATGGACTGGCGCTCCTCGTCCAAAACGCCCTATCCAGCGTGGGCGACCTGGTTGACCAGTTCAAT
GCAGAGTCCGGCCCCGTCGACGCGCCCCCAGAAGCCCCACGACCTACCTTCTCTGCCGATCCGCAGGCCTTTATT
CGCGACATGAGCCTGCATTCCCTGAGTAATGTGGTACGTCTTACGTCGGCGCCTTGATATAGTTGCGGCGACGCT
GACGGCGCAGGCGCTGTCTTTGTTACACATTTACGTCCAGAAGCCGCTCCAAGCGACCGTGGACTTGATCCGGGA
CGCCGAGTCCGAACATGGCCGGTGCTACAGGCAGCTGAGACACTCGTTTGAGCAGCTGCGACTACTCTACACCAC
AAAGCCCGTCATGTCTGCCAAGGAGATGGACCTGCGCCGGACCGAATCGCGAGCCGTGGTTGAGCTGGCCAACCT
CGCCCAGCTCGGCTCCTGGCTGTTTGACGGCAGTGCTCAGGCGCTTGCCGAGGCCGACGACAATTTTTTGGCACT
GTTCAGCTGCCAGGTCGCCGACTTACCGCCCGGGCTGACAGAGCTCTACATCGGCATCATGATCCAGAGAGCGGT
CGAGGGTTTGGTGCTCAAGGAGCCCGAGAAGCCGGCCGAGGAATTGCTGGGAGGGTTGTTGATGGAGGGGCTAGA
GGACAAGCTCAAGCGGCAGCACCAAGGCGTCGAGCTGACGTTGGCCGACCAGAACTTCATCGCGTCGGTGCAATG
CTGGAAAGAGACTCTGGGGGGCGAGTCGCGAGAGCAAGCGGTGTCGAGTATGTGTGTCTCTCTGTTGAGTCGAGT
CGGGAGGCTGACGACGCCCTCTAGCGGCGCTACGTGAGTTGCATCCTTTCAAGTGTCTGCTGCAATCCTTCGTCT
GTCACGTCAAGAGGAGAATGCGGTGTGAATCTCATTGGAACGGCAAATTTGGTGTGACTTTGCAGCTCGACGACG
ACGACGACGACGACGACGATGAGGCTGAGGCCGACGATGCGGCGCTCGCCCTTGACAATGCCGATGCGTCTTGCC
GCGTCACACGGGAGACGGCCGAGGTGGAACTCGACTTGGACGAGATATCGTCTTTGTTGGAAAAGGAGACGAGCA
GTCTCGTGCAGAATGCGCTGGCCGGTCAGACGGAAGATGAAGTATCGGCCTCGGACGGGGCCCAGGCGGACGGCG
GCACGGCATCGACCAACGGCAAGGCCGACCTCATGACCGACTACAAGGAGCTGGAGGCGCTGGTTGCCGCGAGCA
CGTCCCATTACGTCAAGACGACGCTCAACGGGCTCTCGCCGATGCCCTACCAGCCGACGGTGCCCCAGAGCACAG
GTGAGTGGGCGTGAACGCTCTCAGGAGAGGTGGTGAGGCCTGACGCCGCACAGCCGAGGCCATGGCAGCCCAACC
GCCTTATACGCAGCAGCACCACCAGGCACTGCATCCCTACTACCCGAGCGGCCCGCAGCCCCCGGCGGCGGAGGC
GCAGGCCCCTCAACAGGCGGCGCCCGGCGAAGACCTGCCGCCCAACCAGACCTTCCCCAGCGCCATCCTCTACGA
CAAGGCGCGGCAGGCAGCCCTGTCGAAGACGACGGCGCACACAAGGAGGGAGGGCCTCCACTCGACGCGGCGGCC
GTGGTCGCAGGAGGAGGAGAAGGCGTTGATGGCAGGGCTGGACATGGTCAAGGGTCCGCACTGGAGTCAGATCCT
GACGCTGTTTGGGCACAGCGGCACCATTTCGGACATTTTGAAGGACCGGACGCAGGTGCAGCTCAAGGACAAGGC
GCGGAACCTCAAGCTCTTCTTCCTCAAGACCAACTCGGAGATGCCCTACTACTTGCAAGCCGTCACTGGCGAGCT
CAAGACGAGGGCGCCGACGCAGGCGGCGCGCAAGGAGGCCGAGGTCCGGGCCAAGCAGAACTCGGACGAGGACCA
GGCGAGGCTGCAGGGCATCATGGCCCTGGCCGGCGGGCTGCAGGACCCCGCCCCGCCGCCGCAGGCCAAGGTGGT
CAACCCGGCTCATGGGGCTCAGGGGGCTCAGGGGGCTCAGGGGGCCCAGGCGGCGATGCAGCCGGCCGGCCTCTC
GTCGGCGCACAGGCCGCCACCGGCTCAGGGCGGCAGGGCCGGCGGTATGGTTGTACAGGCGACGACGCAGCAAGT
GCTCCAGGCCATGCCGCAGGCGCCCCCTCGGCCGCAGTCGCAGTTCCCGCGGCCGACGACGGGCTTGCAGGCCGC
CGTCCGCCCGAGGCTGGCTCCGGCCCCGAGTCAGCAGCCCGGCGGAGTCGGAGCCGGGTCCGAGCCATCGCGGCC
GTCGGCGTCGGGGGCACGACAGCCGCAGACGACAAAAACACAGCAGGTCGAGGCCAAAGCACAGGCTCAGGCGCC
GCAAAAAGCACCGCCCTCTCCAGTGCCGCCTACTTGTCCCGCTGCTCCTCCTGTTGCTGCGGACTTGACGCAGCA
ACAGCAGCAGCAGCAGCAGCAGCAGCAGCAGGCTCCTCCTGTCCCAGACGCCCCTTCACCGGCGTCCACGCCGTC
TAGTTGGACACGACAAGGAATGGCACAGTCGTCTGCGTCGTCGACAACGACGCCATCGGCACAGACGGCAGAATC
GACGCAGCGCGACGTCGACGGCGCGGAGGCAGCATTGCTGGAAGGCCTCCAGGCTGTGGTGGCACAGACGTTGGC
GTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail