Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4195
Gene name
Locationscaffold_33:41759..44544
Strand-
Gene length (bp)2785
Transcript length (bp)2463
Coding sequence length (bp)2460
Protein length (aa) 820

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 710 732 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 3.79 1.26 6.32
CcL In ants, during behavior modification 0.24 0.00 0.62
CcD In ants, recently dead 0.08 0.00 0.25

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.008884 yes
SC16a CcD 0.080753 no
CcL CcD 1.000000 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4195
MPELTVAYVAGLMAFAIFLARIITPNALAYICSKLLGFQNSAATWTTSSKVLQQSNWPFLLQSDDSYDDSVRWSV
LWISRLMPAVSILLSVASVVTPMGLYPSTGEGKPVEATFVYAPDPTAFGLHGTLSRSNYSMNRACGSVSYANVSF
RYNAKPCPLSKNGDDTFMPSSDPTRPSSLCCLDVDLPASIRDIYSSGYRNSTVSNALDIQWRQYALTTRPGYLNG
SAYIVGRYRNVESLLFEEGLTLVEGLIVDTAKGGIGFRNHTVPIGFPRTVTWEEDLLFIEPETVCVDTNLTLDYT
QDVRFNWGPWPVSRVELTDRGGFSNLDLTMPSVDLSDPQKNPDLRGRAFAAAWMHNVVSAMWFNVTDPTLPLTHV
NSTINQSYSYAGALMTGYPDFSLSKNYYNEFWVYQGRPGVHVFARDASSPGDYNTTFKLRLENYTLINDICRGIN
ESSPATSSNILISCGLLQSIPQREDGGDAFAQEDGTQWMKKLFSCASATKATIKTVTLSYNNTGDNLFDGLKVMS
ARDKEYADEGSMPLWGVEDVGNEYLAGEIGLIWGLVSPEQEGRANVTTYRQPSLYLPGRMSTKSHQIPFMSDGDA
LAGSDFASNMWLGTYCNNLDREARNLVSFEDCDVKQKYEASANMAMWTKWQKLTARAETASRVPNLIFTDFSASA
VVGTKNALGLASTRKRPRFLVTPEILVIRYKLPYAVPAIISAVFVCLILCASVVLTCTGKDGLAGIRQHVQRLAP
GRIYTTLLAPAGEGSDLAMQSKDWSARFGGQLIDLSRDHPIAMQKMAPGDSAGEEEEPEEEMDTVTHHTR
Coding >Ophio5|4195
ATGCCTGAGTTAACAGTTGCCTACGTCGCGGGTCTGATGGCCTTTGCCATTTTTCTTGCTCGAATCATTACTCCC
AATGCTCTCGCTTATATTTGCTCGAAGCTTCTGGGATTCCAAAACTCGGCAGCCACCTGGACAACCAGCTCCAAG
GTGTTGCAGCAATCGAATTGGCCATTTCTCCTCCAGTCCGACGACTCGTATGATGACAGCGTACGCTGGAGCGTT
CTCTGGATTTCCAGATTGATGCCTGCTGTCAGCATATTGCTTTCCGTTGCTTCCGTCGTCACCCCCATGGGCCTG
TATCCCTCTACCGGTGAAGGCAAGCCTGTGGAAGCAACGTTCGTTTACGCACCAGATCCCACAGCCTTTGGTCTG
CACGGGACGTTGAGTCGGAGCAACTACTCTATGAATCGGGCTTGCGGGAGCGTGTCCTATGCCAACGTTTCCTTT
CGTTATAATGCCAAGCCCTGTCCACTTTCCAAGAACGGCGATGACACGTTCATGCCCTCGTCGGATCCCACCAGG
CCAAGCTCTCTTTGCTGTCTCGACGTGGACCTGCCGGCGTCTATAAGGGACATTTACTCGAGCGGCTATCGCAAC
TCGACCGTTTCCAATGCCTTGGACATTCAATGGCGGCAGTACGCTCTGACAACCAGACCGGGCTACCTGAACGGG
TCTGCCTACATTGTCGGTCGCTACAGAAATGTGGAAAGTCTCCTGTTCGAAGAGGGACTGACACTGGTCGAGGGG
TTGATCGTCGACACCGCCAAGGGCGGAATTGGGTTTCGAAACCACACCGTACCTATAGGCTTCCCACGCACAGTC
ACTTGGGAGGAAGACCTCCTCTTTATTGAACCGGAGACTGTCTGCGTCGATACCAACCTAACACTGGATTACACC
CAGGACGTCAGGTTCAACTGGGGCCCGTGGCCCGTCTCACGAGTTGAGCTGACCGATCGAGGTGGATTCTCTAAT
CTTGACCTGACGATGCCTTCCGTGGACTTGAGTGACCCGCAGAAGAACCCCGATCTGCGAGGACGGGCTTTCGCC
GCAGCTTGGATGCACAACGTGGTGAGTGCCATGTGGTTCAACGTGACGGATCCGACGCTGCCCCTGACGCACGTC
AACTCCACCATCAATCAGTCCTACTCGTACGCAGGGGCTCTTATGACAGGCTATCCCGACTTTTCTCTTTCCAAG
AACTATTACAATGAATTCTGGGTCTACCAGGGAAGGCCTGGTGTTCATGTTTTTGCTCGGGATGCTTCGAGCCCT
GGAGACTACAATACCACATTCAAGCTGAGGTTAGAGAACTACACTCTTATCAACGACATATGCCGTGGCATCAAC
GAATCCTCCCCTGCCACGTCCAGCAACATCTTGATCAGCTGTGGTCTGCTGCAGAGTATCCCACAGCGTGAAGAT
GGAGGAGACGCATTCGCACAAGAAGACGGTACCCAGTGGATGAAGAAGTTGTTCTCGTGCGCCTCTGCGACCAAG
GCGACAATCAAGACTGTTACACTGTCGTACAACAACACGGGTGACAACCTATTCGACGGGCTCAAGGTCATGAGC
GCCAGAGATAAAGAGTATGCCGACGAGGGTAGCATGCCACTATGGGGTGTAGAGGACGTCGGAAACGAATATCTG
GCTGGCGAGATAGGGCTGATCTGGGGTCTCGTCTCTCCTGAGCAAGAGGGGAGAGCCAATGTCACGACCTATCGT
CAACCGTCACTCTACCTCCCGGGACGAATGTCAACTAAGAGCCATCAAATCCCCTTCATGTCCGACGGAGATGCC
CTGGCCGGCAGCGACTTTGCCTCCAACATGTGGCTAGGAACCTACTGCAATAACCTGGACCGGGAGGCCAGAAAC
CTGGTCAGCTTCGAGGACTGCGACGTCAAACAGAAATACGAGGCTTCGGCCAACATGGCCATGTGGACCAAGTGG
CAGAAGCTGACGGCGAGGGCCGAAACGGCATCTCGAGTCCCGAACCTGATATTCACCGACTTTTCTGCCTCTGCC
GTCGTCGGCACCAAGAACGCCTTGGGCCTGGCATCGACAAGAAAGAGGCCTCGATTCCTCGTTACACCGGAGATT
CTGGTCATCAGGTACAAGCTTCCCTACGCCGTGCCGGCCATCATCTCAGCCGTCTTTGTCTGTCTCATCCTCTGC
GCCTCCGTCGTCCTCACATGCACCGGGAAGGACGGCCTGGCTGGCATCCGCCAGCATGTTCAGCGGCTTGCGCCA
GGCCGAATCTATACCACGCTTCTGGCACCTGCGGGAGAGGGGAGCGACTTGGCCATGCAGAGCAAAGACTGGAGC
GCGCGATTTGGCGGCCAGCTCATCGATCTCTCGCGAGACCATCCGATAGCGATGCAGAAAATGGCACCTGGAGAT
AGTGCAGGAGAAGAAGAAGAGCCTGAGGAGGAGATGGACACAGTCACTCATCACACAAGG
Transcript >Ophio5|4195
ATGCCTGAGTTAACAGTTGCCTACGTCGCGGGTCTGATGGCCTTTGCCATTTTTCTTGCTCGAATCATTACTCCC
AATGCTCTCGCTTATATTTGCTCGAAGCTTCTGGGATTCCAAAACTCGGCAGCCACCTGGACAACCAGCTCCAAG
GTGTTGCAGCAATCGAATTGGCCATTTCTCCTCCAGTCCGACGACTCGTATGATGACAGCGTACGCTGGAGCGTT
CTCTGGATTTCCAGATTGATGCCTGCTGTCAGCATATTGCTTTCCGTTGCTTCCGTCGTCACCCCCATGGGCCTG
TATCCCTCTACCGGTGAAGGCAAGCCTGTGGAAGCAACGTTCGTTTACGCACCAGATCCCACAGCCTTTGGTCTG
CACGGGACGTTGAGTCGGAGCAACTACTCTATGAATCGGGCTTGCGGGAGCGTGTCCTATGCCAACGTTTCCTTT
CGTTATAATGCCAAGCCCTGTCCACTTTCCAAGAACGGCGATGACACGTTCATGCCCTCGTCGGATCCCACCAGG
CCAAGCTCTCTTTGCTGTCTCGACGTGGACCTGCCGGCGTCTATAAGGGACATTTACTCGAGCGGCTATCGCAAC
TCGACCGTTTCCAATGCCTTGGACATTCAATGGCGGCAGTACGCTCTGACAACCAGACCGGGCTACCTGAACGGG
TCTGCCTACATTGTCGGTCGCTACAGAAATGTGGAAAGTCTCCTGTTCGAAGAGGGACTGACACTGGTCGAGGGG
TTGATCGTCGACACCGCCAAGGGCGGAATTGGGTTTCGAAACCACACCGTACCTATAGGCTTCCCACGCACAGTC
ACTTGGGAGGAAGACCTCCTCTTTATTGAACCGGAGACTGTCTGCGTCGATACCAACCTAACACTGGATTACACC
CAGGACGTCAGGTTCAACTGGGGCCCGTGGCCCGTCTCACGAGTTGAGCTGACCGATCGAGGTGGATTCTCTAAT
CTTGACCTGACGATGCCTTCCGTGGACTTGAGTGACCCGCAGAAGAACCCCGATCTGCGAGGACGGGCTTTCGCC
GCAGCTTGGATGCACAACGTGGTGAGTGCCATGTGGTTCAACGTGACGGATCCGACGCTGCCCCTGACGCACGTC
AACTCCACCATCAATCAGTCCTACTCGTACGCAGGGGCTCTTATGACAGGCTATCCCGACTTTTCTCTTTCCAAG
AACTATTACAATGAATTCTGGGTCTACCAGGGAAGGCCTGGTGTTCATGTTTTTGCTCGGGATGCTTCGAGCCCT
GGAGACTACAATACCACATTCAAGCTGAGGTTAGAGAACTACACTCTTATCAACGACATATGCCGTGGCATCAAC
GAATCCTCCCCTGCCACGTCCAGCAACATCTTGATCAGCTGTGGTCTGCTGCAGAGTATCCCACAGCGTGAAGAT
GGAGGAGACGCATTCGCACAAGAAGACGGTACCCAGTGGATGAAGAAGTTGTTCTCGTGCGCCTCTGCGACCAAG
GCGACAATCAAGACTGTTACACTGTCGTACAACAACACGGGTGACAACCTATTCGACGGGCTCAAGGTCATGAGC
GCCAGAGATAAAGAGTATGCCGACGAGGGTAGCATGCCACTATGGGGTGTAGAGGACGTCGGAAACGAATATCTG
GCTGGCGAGATAGGGCTGATCTGGGGTCTCGTCTCTCCTGAGCAAGAGGGGAGAGCCAATGTCACGACCTATCGT
CAACCGTCACTCTACCTCCCGGGACGAATGTCAACTAAGAGCCATCAAATCCCCTTCATGTCCGACGGAGATGCC
CTGGCCGGCAGCGACTTTGCCTCCAACATGTGGCTAGGAACCTACTGCAATAACCTGGACCGGGAGGCCAGAAAC
CTGGTCAGCTTCGAGGACTGCGACGTCAAACAGAAATACGAGGCTTCGGCCAACATGGCCATGTGGACCAAGTGG
CAGAAGCTGACGGCGAGGGCCGAAACGGCATCTCGAGTCCCGAACCTGATATTCACCGACTTTTCTGCCTCTGCC
GTCGTCGGCACCAAGAACGCCTTGGGCCTGGCATCGACAAGAAAGAGGCCTCGATTCCTCGTTACACCGGAGATT
CTGGTCATCAGGTACAAGCTTCCCTACGCCGTGCCGGCCATCATCTCAGCCGTCTTTGTCTGTCTCATCCTCTGC
GCCTCCGTCGTCCTCACATGCACCGGGAAGGACGGCCTGGCTGGCATCCGCCAGCATGTTCAGCGGCTTGCGCCA
GGCCGAATCTATACCACGCTTCTGGCACCTGCGGGAGAGGGGAGCGACTTGGCCATGCAGAGCAAAGACTGGAGC
GCGCGATTTGGCGGCCAGCTCATCGATCTCTCGCGAGACCATCCGATAGCGATGCAGAAAATGGCACCTGGAGAT
AGTGCAGGAGAAGAAGAAGAGCCTGAGGAGGAGATGGACACAGTCACTCATCACACAAGGTAG
Gene >Ophio5|4195
ATGCCTGAGTTAACAGTTGCCTACGTCGCGGGTCTGATGGCCTTTGCCATTTTTCTTGGTATGAACTCGGCTGTC
CTATGTTGGTCAACTTGATAGTAAGAACCAAAAAAAAAAAAAAANNNNNNNNNNNNNNNNNNNNNNAAAAGAGAG
AGAGAGAGAAACTGACAGACGACGGCGTGATTCCAAGCTCGAATCATTACTCCCAATGCTCTCGCTTATATTTGC
TCGAAGCTTCTGGGATTCCAAAACTCGGCAGCCACCTGGTCGGTTTCATTCGTCAGAGCAAATCACGTCGTGCTG
ACTTGGAGCCGCAGGACAACCAGCTCCAAGGTGTTGCAGCAATCGAATTGGCCATTTCTCCTCCAGTCCGACGAC
TCGTATGATGACAGCGTACGCTGGAGCGTTCTCTGGATTTCCAGATTGATGCCTGCTGTCAGCATATTGCTTTCC
GTTGCTTCCGTCGTCACCCCCATGGGCCTGTATCCCTCTACCGGTGAAGGCAAGCCTGTGGAAGCAACGTTCGGT
GAGCACATGAAAAAGCTCAAATGATGCTCGTAGCCAGCATCTGACGCTGGCTCAAAGTTTACGCACCAGATCCCA
CAGCCTTTGGTCTGCACGGGACGTTGAGTCGGAGCAACTACTCTATGAATCGGGCTTGCGGGAGCGTGTCCTATG
CCAACGTTTCCTTTCGTTATAATGCCAAGCCCTGTCCACTTTCCAAGAACGGCGATGACACGTTCATGCCCTCGT
CGGATCCCACCAGGCCAAGCTCTCTTTGCTGTCTCGACGTGGACCTGCCGGCGTCTATAAGGGACATTTACTCGA
GCGGCTATCGCAACTCGACCGTTTCCAATGCCTTGGACATTCAATGGCGGCAGTACGCTCTGACAACCAGACCGG
GCTACCTGAACGGGTCTGCCTACATTGTCGGTCGCTACAGAAATGTGGAAAGTCTCCTGTTCGAAGAGGGACTGA
CACTGGTCGAGGGGTTGATCGTCGACACCGCCAAGGGCGGAATTGGGTTTCGAAACCACACCGTACCTATAGGCT
TCCCACGCACAGTCACTTGGGAGGAAGACCTCCTCTTTATTGAACCGGAGACTGTCTGCGTCGATACCAACCTAA
CACTGGATTACACCCAGGACGTCAGGTTCAACTGGGGCCCGTGGCCCGTCTCACGAGTTGAGCTGACCGATCGAG
GTGGATTCTCTAATCTTGACCTGACGATGCCTTCCGTGGACTTGAGTGACCCGCAGAAGAACCCCGATCTGCGAG
GACGGGCTTTCGCCGCAGCTTGGATGCACAACGTGGTGAGTGCCATGTGGTTCAACGTGACGGATCCGACGCTGC
CCCTGACGCACGTCAACTCCACCATCAATCAGTCCTACTCGTACGCAGGGGCTCTTATGACAGGCTATCCCGACT
TTTCTCTTTCCAAGAACTATTACAATGAATTCTGGGTCTACCAGGGAAGGCCTGGTGTTCATGTTTTTGCTCGGG
ATGCTTCGAGCCCTGGAGACTACAATACCACATTCAAGCTGAGGTTAGAGAACTACACTCTTATCAGTACGTTTT
CAAAGCTATCTAGCCTGTGTGCCGCCGATATCTTTTGAAGAAGCCATGGCGAATCTAACAAAGCATCTTTCTAGA
CGACATATGCCGTGGCATCAACGAATCCTCCCCTGCCACGTCCAGCAACATCTTGATCAGCTGTGGTCTGCTGCA
GAGTATCCCACAGCGTGAAGATGGAGGAGACGCATTCGCACAAGAAGACGGTACCCAGTGGATGAAGAAGTTGTT
CTCGTGCGCCTCTGCGACCAAGGCGACAATCAAGACTGTTACACTGTCGTACAACAACACGGGTGACAACCTATT
CGACGGGCTCAAGGTCATGAGCGCCAGAGATAAAGAGTATGCCGACGAGGGTAGCATGCCACTATGGGGTGTAGA
GGACGTCGGAAACGAATATCTGGCTGGCGAGATAGGGCTGATCTGGGGTCTCGTCTCTCCTGAGCAAGAGGGGAG
AGCCAATGTCACGACCTATCGTCAACCGTCACTCTACCTCCCGGGACGAATGTCAACTAAGAGCCATCAAATCCC
CTTCATGTCCGACGGAGATGCCCTGGCCGGCAGCGACTTTGCCTCCAACATGTGGCTAGGAACCTACTGCAATAA
CCTGGACCGGGAGGCCAGAAACCTGGTCAGCTTCGAGGACTGCGACGTCAAACAGAAATACGAGGCTTCGGCCAA
CATGGCCATGTGGACCAAGTGGCAGAAGCTGACGGCGAGGGCCGAAACGGCATCTCGAGTCCCGAACCTGATATT
CACCGACTTTTCTGCCTCTGCCGTCGTCGGCACCAAGAACGCCTTGGGCCTGGCATCGACAAGAAAGAGGCCTCG
ATTCCTCGTTACACCGGAGATTCTGGTCATCAGGTACAAGCTTCCCTACGCCGTGCCGGCCATCATCTCAGCCGT
CTTTGTCTGTCTCATCCTCTGCGCCTCCGTCGTCCTCACATGCACCGGGAAGGACGGCCTGGCTGGCATCCGCCA
GCATGTTCAGCGGCTTGCGCCAGGCCGAATCTATACCACGCTTCTGGCACCTGCGGGAGAGGGGAGCGACTTGGC
CATGCAGAGCAAAGACTGGAGCGCGCGATTTGGCGGCCAGCTCATCGATCTCTCGCGAGACCATCCGATAGCGAT
GCAGAAAATGGCACCTGGAGATAGTGCAGGAGAAGAAGAAGAGCCTGAGGAGGAGATGGACACAGTCACTCATCA
CACAAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail