Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4169
Gene name
Locationscaffold_328:16959..17823
Strand-
Gene length (bp)864
Transcript length (bp)627
Coding sequence length (bp)624
Protein length (aa) 208

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 13 193 2.0E-18
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 19 176 3.0E-17
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 23 167 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 63 85 22
2 105 122 17
3 129 147 18

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4169
MTKYQADHFSSGGIVLPPPGTVELISQDTSQQFDPEPAAVALMPVPSDDPNDPLNWSRFRKCYHFGLLMAMTMVI
FSVLSTQPVFWTQMLEELDITQEDLDNAQAFQLIGLAVGCVFFIPVAKKYGRRPIYIVSTALVTGAAWWSAFMRT
SNEIILTNVIMGLAGATNETAVQMSVGIPLTASLEQSYGIPQGDHPYAARCMFHRLIC
Coding >Ophio5|4169
ATGACAAAGTATCAAGCGGACCATTTTTCTTCAGGAGGCATTGTCCTCCCACCACCGGGAACTGTTGAGTTGATC
TCTCAGGACACCAGCCAGCAGTTCGATCCAGAACCCGCGGCCGTGGCGTTGATGCCGGTCCCCTCGGACGACCCA
AATGATCCCTTGAACTGGTCGCGCTTCCGCAAGTGCTATCACTTTGGTCTTCTGATGGCGATGACCATGGTCATA
TTCTCTGTACTATCTACTCAGCCGGTATTTTGGACTCAAATGCTAGAAGAGCTAGATATAACGCAAGAAGACCTC
GATAACGCCCAGGCGTTTCAGCTGATCGGGTTGGCGGTGGGATGCGTCTTCTTCATCCCGGTAGCCAAGAAGTAC
GGCCGACGTCCGATCTATATCGTCTCAACAGCCCTCGTCACGGGTGCCGCCTGGTGGTCCGCATTTATGCGTACA
TCAAACGAGATTATTCTGACCAATGTCATCATGGGCCTTGCCGGTGCCACCAATGAGACGGCTGTTCAGATGAGC
GTAGGCATTCCCTTGACTGCATCCCTAGAGCAATCTTATGGCATACCCCAAGGAGATCACCCCTATGCCGCCCGG
TGTATGTTTCACAGACTCATATGC
Transcript >Ophio5|4169
ATGACAAAGTATCAAGCGGACCATTTTTCTTCAGGAGGCATTGTCCTCCCACCACCGGGAACTGTTGAGTTGATC
TCTCAGGACACCAGCCAGCAGTTCGATCCAGAACCCGCGGCCGTGGCGTTGATGCCGGTCCCCTCGGACGACCCA
AATGATCCCTTGAACTGGTCGCGCTTCCGCAAGTGCTATCACTTTGGTCTTCTGATGGCGATGACCATGGTCATA
TTCTCTGTACTATCTACTCAGCCGGTATTTTGGACTCAAATGCTAGAAGAGCTAGATATAACGCAAGAAGACCTC
GATAACGCCCAGGCGTTTCAGCTGATCGGGTTGGCGGTGGGATGCGTCTTCTTCATCCCGGTAGCCAAGAAGTAC
GGCCGACGTCCGATCTATATCGTCTCAACAGCCCTCGTCACGGGTGCCGCCTGGTGGTCCGCATTTATGCGTACA
TCAAACGAGATTATTCTGACCAATGTCATCATGGGCCTTGCCGGTGCCACCAATGAGACGGCTGTTCAGATGAGC
GTAGGCATTCCCTTGACTGCATCCCTAGAGCAATCTTATGGCATACCCCAAGGAGATCACCCCTATGCCGCCCGG
TGTATGTTTCACAGACTCATATGCTAA
Gene >Ophio5|4169
ATGACAAAGTATCAAGCGGACCATTTTTCTTCAGGAGGCATTGTCCTCCCACCACCGGGAACTGTTGAGTTGATC
TCTCGTAAGTAGTGCATCTCGTCTTCACTCGCAACGTTTGCTTGGTGCTGGTAGGCAGATGTCAGCTGACCATTG
ATGGATCCCTCCAGAGGACACCAGCCAGCAGTTCGATCCAGAACCCGCGGCCGTGGCGTTGATGCCGGTCCCCTC
GGACGACCCAAATGATCCCTTGGTCAGTGTAGAAACCACTTCCCCCTCTTTTTTTACACATCAAAAGACTCATCT
ACTCAAACGATTCACTAGAACTGGTCGCGCTTCCGCAAGTGCTATCACTTTGGTCTTCTGATGGCGATGACCATG
GTCATATTCTCTGTGTGAGTGCATGTTTCCTGACATGAAACGGAATTCCATGATAATGAAGTCTATGGTCTCTCG
CCTAACTTAGTGACATATAGACTATCTACTCAGCCGGTATTTTGGACTCAAATGCTAGAAGAGCTAGATATAACG
CAAGAAGACCTCGATAACGCCCAGGCGTTTCAGCTGATCGGGTTGGCGGTGGGATGCGTCTTCTTCATCCCGGTA
GCCAAGAAGTACGGCCGACGTCCGATCTATATCGTCTCAACAGCCCTCGTCACGGGTGCCGCCTGGTGGTCCGCA
TTTATGCGTACATCAAACGAGATTATTCTGACCAATGTCATCATGGGCCTTGCCGGTGCCACCAATGAGACGGCT
GTTCAGATGAGCGTAGGCATTCCCTTGACTGCATCCCTAGAGCAATCTTATGGCATACCCCAAGGAGATCACCCC
TATGCCGCCCGGTGTATGTTTCACAGACTCATATGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail