Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4168
Gene name
Locationscaffold_328:15714..16842
Strand-
Gene length (bp)1128
Transcript length (bp)999
Coding sequence length (bp)996
Protein length (aa) 332

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 28 326 2.0E-28
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 137 330 5.0E-24
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 101 314 1.0E-16
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 91 291 4.0E-11
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 54 272 4.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 28 326 2.0E-28
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 137 330 5.0E-24
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 101 314 1.0E-16
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 91 291 4.0E-11
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 54 272 4.0E-09
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 139 290 2.0E-07
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cell membrane Transmembrane domain 0.0754 0.0906 0.0951 0.7431 0.1238 0.006 0.3731 0.43 0.4201 0.0379

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 15 34 19
2 107 129 22
3 149 171 22
4 191 213 22
5 223 245 22
6 252 274 22
7 284 306 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup21
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|781
Ophiocordyceps australis 1348a (Ghana) OphauG2|3621
Ophiocordyceps australis map64 (Brazil) OphauB2|135
Ophiocordyceps australis map64 (Brazil) OphauB2|4856
Ophiocordyceps camponoti-floridani Ophcf2|05528
Ophiocordyceps camponoti-floridani Ophcf2|03539
Ophiocordyceps camponoti-floridani Ophcf2|02729
Ophiocordyceps camponoti-floridani Ophcf2|00664
Ophiocordyceps camponoti-rufipedis Ophun1|3781
Ophiocordyceps camponoti-rufipedis Ophun1|1856
Ophiocordyceps camponoti-rufipedis Ophun1|435
Ophiocordyceps camponoti-rufipedis Ophun1|607
Ophiocordyceps kimflemingae Ophio5|4168 (this protein)
Ophiocordyceps kimflemingae Ophio5|4169
Ophiocordyceps kimflemingae Ophio5|5392
Ophiocordyceps kimflemingae Ophio5|6880
Ophiocordyceps kimflemingae Ophio5|741
Ophiocordyceps subramaniannii Hirsu2|7470
Ophiocordyceps subramaniannii Hirsu2|7469
Ophiocordyceps subramaniannii Hirsu2|7335
Ophiocordyceps subramaniannii Hirsu2|6881
Ophiocordyceps subramaniannii Hirsu2|6880
Ophiocordyceps subramaniannii Hirsu2|5938
Ophiocordyceps subramaniannii Hirsu2|1965
Ophiocordyceps subramaniannii Hirsu2|9409
Ophiocordyceps subramaniannii Hirsu2|10936

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4168
MAAGAQTLYSGWRSSYLTVACFMTALTLLFLVSFEETKFVPPPQQNSDIDFSDGASVRKDNTMEFVSTMPVESSV
PTSTQRSRLRLQLITKTNESILRDMYYPVLTAWYPQVVFTYIEFASGVTWVVITSLMTSIIFSKPPYNFNSLQVG
FMFGGTLVGSVFGSLYGGWLVDWAIVRFAKRNRGVFEPEMRLWLFPLPGLAMSAGLVVFGVTADRGMHWIFPSIG
AGLFGYGFGAVSDITFTLVIDSFPNLVAQTFVVIAFFRNAISIAGPFSIVPWMEAMSVSAIFIIAGSISMGIHLF
AVPLVIWGKKARESIAPRYYRLTERLYPGVMG
Coding >Ophio5|4168
ATGGCTGCTGGTGCACAAACACTCTATTCGGGGTGGCGGTCATCCTATCTCACGGTTGCCTGTTTTATGACGGCC
CTTACATTACTCTTCCTAGTTTCCTTTGAGGAAACTAAATTCGTTCCCCCTCCGCAGCAGAACTCCGACATCGAC
TTCAGCGATGGCGCCAGCGTGCGAAAAGACAACACCATGGAATTCGTTTCAACGATGCCTGTGGAATCGTCAGTT
CCCACAAGTACCCAGCGATCGCGTCTCAGACTCCAGCTCATTACCAAGACTAACGAGTCGATTTTGAGGGACATG
TATTATCCTGTACTTACAGCCTGGTATCCTCAGGTCGTGTTCACCTACATCGAATTCGCGTCCGGTGTTACCTGG
GTTGTCATCACCTCCCTTATGACCTCCATAATCTTTTCCAAACCGCCCTACAACTTCAATTCTCTTCAAGTCGGC
TTCATGTTTGGAGGCACCTTGGTTGGCTCCGTCTTTGGTAGTCTATACGGCGGATGGCTTGTCGATTGGGCCATT
GTACGATTTGCAAAGAGGAACCGAGGTGTTTTTGAGCCGGAAATGCGTCTTTGGCTCTTTCCTCTTCCAGGCCTC
GCCATGTCGGCTGGTCTCGTCGTCTTCGGCGTTACAGCTGACCGGGGCATGCACTGGATATTCCCCAGCATCGGG
GCCGGCCTTTTTGGCTACGGATTTGGCGCTGTATCCGACATAACCTTTACTCTAGTCATCGATTCTTTCCCGAAT
CTCGTTGCGCAAACTTTTGTCGTCATTGCGTTTTTCCGCAACGCAATTAGTATTGCCGGCCCCTTTTCCATCGTT
CCTTGGATGGAAGCCATGAGTGTCAGTGCCATTTTCATCATCGCTGGCTCTATCAGTATGGGCATCCACCTTTTC
GCTGTGCCGCTCGTCATCTGGGGCAAGAAAGCAAGAGAGAGCATCGCGCCTCGGTACTACCGCCTTACGGAGAGA
TTATACCCTGGGGTGATGGGC
Transcript >Ophio5|4168
ATGGCTGCTGGTGCACAAACACTCTATTCGGGGTGGCGGTCATCCTATCTCACGGTTGCCTGTTTTATGACGGCC
CTTACATTACTCTTCCTAGTTTCCTTTGAGGAAACTAAATTCGTTCCCCCTCCGCAGCAGAACTCCGACATCGAC
TTCAGCGATGGCGCCAGCGTGCGAAAAGACAACACCATGGAATTCGTTTCAACGATGCCTGTGGAATCGTCAGTT
CCCACAAGTACCCAGCGATCGCGTCTCAGACTCCAGCTCATTACCAAGACTAACGAGTCGATTTTGAGGGACATG
TATTATCCTGTACTTACAGCCTGGTATCCTCAGGTCGTGTTCACCTACATCGAATTCGCGTCCGGTGTTACCTGG
GTTGTCATCACCTCCCTTATGACCTCCATAATCTTTTCCAAACCGCCCTACAACTTCAATTCTCTTCAAGTCGGC
TTCATGTTTGGAGGCACCTTGGTTGGCTCCGTCTTTGGTAGTCTATACGGCGGATGGCTTGTCGATTGGGCCATT
GTACGATTTGCAAAGAGGAACCGAGGTGTTTTTGAGCCGGAAATGCGTCTTTGGCTCTTTCCTCTTCCAGGCCTC
GCCATGTCGGCTGGTCTCGTCGTCTTCGGCGTTACAGCTGACCGGGGCATGCACTGGATATTCCCCAGCATCGGG
GCCGGCCTTTTTGGCTACGGATTTGGCGCTGTATCCGACATAACCTTTACTCTAGTCATCGATTCTTTCCCGAAT
CTCGTTGCGCAAACTTTTGTCGTCATTGCGTTTTTCCGCAACGCAATTAGTATTGCCGGCCCCTTTTCCATCGTT
CCTTGGATGGAAGCCATGAGTGTCAGTGCCATTTTCATCATCGCTGGCTCTATCAGTATGGGCATCCACCTTTTC
GCTGTGCCGCTCGTCATCTGGGGCAAGAAAGCAAGAGAGAGCATCGCGCCTCGGTACTACCGCCTTACGGAGAGA
TTATACCCTGGGGTGATGGGCTAG
Gene >Ophio5|4168
ATGGCTGCTGGTGCACAAACACTCTATTCGGGGTGGCGGTCATCCTATCTCACGGTTGCCTGTTTTATGACGGCC
CTTACATTACTCTTCCTAGTTTCCTTTGAGGAAACTAAATTCGTTCCCCCTCCGCAGCAGAACTCCGACATCGAC
TTCAGCGATGGCGCCAGCGTGCGAAAAGACAACACCATGGAATTCGTTTCAACGATGCCTGTGGAATCGTCAGTT
CCCACAAGTACCCAGCGATCGCGTCTCAGACTCCAGCTCATTACCAAGACTAACGAGTCGATTTTGAGGGACATG
TATTATCCTGTACTTACAGCCTGGTATCCTCAGGTCGTGTTCACCTACATCGAATTCGCGTCCGGTGTTACCTGG
GTTGTCATCACCTCCCTTATGACCTCCATAATCTTTTCCAAACCGCCCTACAACTTCAATTCTCTTCAAGTCGGC
TTCATGTTTGGAGGCACCTTGGTTGGCTCCGTCTTTGGTAGTCTATACGGCGGATGGCTTGTCGATTGGGCCATT
GTACGATTTGCAAAGAGGAACCGAGGTGTTTTTGAGCCGGAAATGCGTCTTTGGCTCTTTCCTCTTCCAGGCCTC
GCCATGTCGGCTGGTCTCGTCGTCTTCGGCGTTACAGCTGACCGGGTATGCACTCCCGCCACCCTCAATGCTGCC
ATTGCTGCCTGAAACGACAGCTAACCTTGTGAAACATATAGGGCATGCACTGGATATTCCCCAGCATCGGGGCCG
GCCTTTTTGGCTACGGATTTGGCGCTGTATCCGACATAACCTTTACTCTAGTCATCGATTCTTTCCCGAATGTAA
GTAGGCCGGTTGAGCCTGTTTCCTTCCATGACATTAACAATGGTTCTTTCTCAGCTCGTTGCGCAAACTTTTGTC
GTCATTGCGTTTTTCCGCAACGCAATTAGTATTGCCGGCCCCTTTTCCATCGTTCCTTGGATGGAAGCCATGAGT
GTCAGTGCCATTTTCATCATCGCTGGCTCTATCAGTATGGGCATCCACCTTTTCGCTGTGCCGCTCGTCATCTGG
GGCAAGAAAGCAAGAGAGAGCATCGCGCCTCGGTACTACCGCCTTACGGAGAGATTATACCCTGGGGTGATGGGC
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail