Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4168
Gene name
Locationscaffold_328:15714..16842
Strand-
Gene length (bp)1128
Transcript length (bp)999
Coding sequence length (bp)996
Protein length (aa) 332

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 28 326 2.0E-28
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 137 330 5.0E-24
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 101 314 1.0E-16
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 91 291 4.0E-11
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 54 272 4.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 28 326 2.0E-28
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 137 330 5.0E-24
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 101 314 1.0E-16
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 91 291 4.0E-11
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 54 272 4.0E-09
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 139 290 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 15 34 19
2 107 129 22
3 149 171 22
4 191 213 22
5 223 245 22
6 252 274 22
7 284 306 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4168
MAAGAQTLYSGWRSSYLTVACFMTALTLLFLVSFEETKFVPPPQQNSDIDFSDGASVRKDNTMEFVSTMPVESSV
PTSTQRSRLRLQLITKTNESILRDMYYPVLTAWYPQVVFTYIEFASGVTWVVITSLMTSIIFSKPPYNFNSLQVG
FMFGGTLVGSVFGSLYGGWLVDWAIVRFAKRNRGVFEPEMRLWLFPLPGLAMSAGLVVFGVTADRGMHWIFPSIG
AGLFGYGFGAVSDITFTLVIDSFPNLVAQTFVVIAFFRNAISIAGPFSIVPWMEAMSVSAIFIIAGSISMGIHLF
AVPLVIWGKKARESIAPRYYRLTERLYPGVMG
Coding >Ophio5|4168
ATGGCTGCTGGTGCACAAACACTCTATTCGGGGTGGCGGTCATCCTATCTCACGGTTGCCTGTTTTATGACGGCC
CTTACATTACTCTTCCTAGTTTCCTTTGAGGAAACTAAATTCGTTCCCCCTCCGCAGCAGAACTCCGACATCGAC
TTCAGCGATGGCGCCAGCGTGCGAAAAGACAACACCATGGAATTCGTTTCAACGATGCCTGTGGAATCGTCAGTT
CCCACAAGTACCCAGCGATCGCGTCTCAGACTCCAGCTCATTACCAAGACTAACGAGTCGATTTTGAGGGACATG
TATTATCCTGTACTTACAGCCTGGTATCCTCAGGTCGTGTTCACCTACATCGAATTCGCGTCCGGTGTTACCTGG
GTTGTCATCACCTCCCTTATGACCTCCATAATCTTTTCCAAACCGCCCTACAACTTCAATTCTCTTCAAGTCGGC
TTCATGTTTGGAGGCACCTTGGTTGGCTCCGTCTTTGGTAGTCTATACGGCGGATGGCTTGTCGATTGGGCCATT
GTACGATTTGCAAAGAGGAACCGAGGTGTTTTTGAGCCGGAAATGCGTCTTTGGCTCTTTCCTCTTCCAGGCCTC
GCCATGTCGGCTGGTCTCGTCGTCTTCGGCGTTACAGCTGACCGGGGCATGCACTGGATATTCCCCAGCATCGGG
GCCGGCCTTTTTGGCTACGGATTTGGCGCTGTATCCGACATAACCTTTACTCTAGTCATCGATTCTTTCCCGAAT
CTCGTTGCGCAAACTTTTGTCGTCATTGCGTTTTTCCGCAACGCAATTAGTATTGCCGGCCCCTTTTCCATCGTT
CCTTGGATGGAAGCCATGAGTGTCAGTGCCATTTTCATCATCGCTGGCTCTATCAGTATGGGCATCCACCTTTTC
GCTGTGCCGCTCGTCATCTGGGGCAAGAAAGCAAGAGAGAGCATCGCGCCTCGGTACTACCGCCTTACGGAGAGA
TTATACCCTGGGGTGATGGGC
Transcript >Ophio5|4168
ATGGCTGCTGGTGCACAAACACTCTATTCGGGGTGGCGGTCATCCTATCTCACGGTTGCCTGTTTTATGACGGCC
CTTACATTACTCTTCCTAGTTTCCTTTGAGGAAACTAAATTCGTTCCCCCTCCGCAGCAGAACTCCGACATCGAC
TTCAGCGATGGCGCCAGCGTGCGAAAAGACAACACCATGGAATTCGTTTCAACGATGCCTGTGGAATCGTCAGTT
CCCACAAGTACCCAGCGATCGCGTCTCAGACTCCAGCTCATTACCAAGACTAACGAGTCGATTTTGAGGGACATG
TATTATCCTGTACTTACAGCCTGGTATCCTCAGGTCGTGTTCACCTACATCGAATTCGCGTCCGGTGTTACCTGG
GTTGTCATCACCTCCCTTATGACCTCCATAATCTTTTCCAAACCGCCCTACAACTTCAATTCTCTTCAAGTCGGC
TTCATGTTTGGAGGCACCTTGGTTGGCTCCGTCTTTGGTAGTCTATACGGCGGATGGCTTGTCGATTGGGCCATT
GTACGATTTGCAAAGAGGAACCGAGGTGTTTTTGAGCCGGAAATGCGTCTTTGGCTCTTTCCTCTTCCAGGCCTC
GCCATGTCGGCTGGTCTCGTCGTCTTCGGCGTTACAGCTGACCGGGGCATGCACTGGATATTCCCCAGCATCGGG
GCCGGCCTTTTTGGCTACGGATTTGGCGCTGTATCCGACATAACCTTTACTCTAGTCATCGATTCTTTCCCGAAT
CTCGTTGCGCAAACTTTTGTCGTCATTGCGTTTTTCCGCAACGCAATTAGTATTGCCGGCCCCTTTTCCATCGTT
CCTTGGATGGAAGCCATGAGTGTCAGTGCCATTTTCATCATCGCTGGCTCTATCAGTATGGGCATCCACCTTTTC
GCTGTGCCGCTCGTCATCTGGGGCAAGAAAGCAAGAGAGAGCATCGCGCCTCGGTACTACCGCCTTACGGAGAGA
TTATACCCTGGGGTGATGGGCTAG
Gene >Ophio5|4168
ATGGCTGCTGGTGCACAAACACTCTATTCGGGGTGGCGGTCATCCTATCTCACGGTTGCCTGTTTTATGACGGCC
CTTACATTACTCTTCCTAGTTTCCTTTGAGGAAACTAAATTCGTTCCCCCTCCGCAGCAGAACTCCGACATCGAC
TTCAGCGATGGCGCCAGCGTGCGAAAAGACAACACCATGGAATTCGTTTCAACGATGCCTGTGGAATCGTCAGTT
CCCACAAGTACCCAGCGATCGCGTCTCAGACTCCAGCTCATTACCAAGACTAACGAGTCGATTTTGAGGGACATG
TATTATCCTGTACTTACAGCCTGGTATCCTCAGGTCGTGTTCACCTACATCGAATTCGCGTCCGGTGTTACCTGG
GTTGTCATCACCTCCCTTATGACCTCCATAATCTTTTCCAAACCGCCCTACAACTTCAATTCTCTTCAAGTCGGC
TTCATGTTTGGAGGCACCTTGGTTGGCTCCGTCTTTGGTAGTCTATACGGCGGATGGCTTGTCGATTGGGCCATT
GTACGATTTGCAAAGAGGAACCGAGGTGTTTTTGAGCCGGAAATGCGTCTTTGGCTCTTTCCTCTTCCAGGCCTC
GCCATGTCGGCTGGTCTCGTCGTCTTCGGCGTTACAGCTGACCGGGTATGCACTCCCGCCACCCTCAATGCTGCC
ATTGCTGCCTGAAACGACAGCTAACCTTGTGAAACATATAGGGCATGCACTGGATATTCCCCAGCATCGGGGCCG
GCCTTTTTGGCTACGGATTTGGCGCTGTATCCGACATAACCTTTACTCTAGTCATCGATTCTTTCCCGAATGTAA
GTAGGCCGGTTGAGCCTGTTTCCTTCCATGACATTAACAATGGTTCTTTCTCAGCTCGTTGCGCAAACTTTTGTC
GTCATTGCGTTTTTCCGCAACGCAATTAGTATTGCCGGCCCCTTTTCCATCGTTCCTTGGATGGAAGCCATGAGT
GTCAGTGCCATTTTCATCATCGCTGGCTCTATCAGTATGGGCATCCACCTTTTCGCTGTGCCGCTCGTCATCTGG
GGCAAGAAAGCAAGAGAGAGCATCGCGCCTCGGTACTACCGCCTTACGGAGAGATTATACCCTGGGGTGATGGGC
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail