Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4162
Gene name
Locationscaffold_327:19907..21393
Strand-
Gene length (bp)1486
Transcript length (bp)1317
Coding sequence length (bp)1314
Protein length (aa) 438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 6.5E-12 89 420

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4AV38|LIP4_ARTBC Probable secreted lipase ARB_00047 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00047 PE=1 SV=1 41 430 1.0E-66

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4162
MQMSTNKNNSNGPETATPPSDDDDANISLPQLEAHLAPVGQPVEGAFSTRTVLFVRAYWAAEDGEQERAGGHMYV
ERLDPLLTVQPLPIILIHGDWHTGQVWNTKPDGKPGWASYFNYQGYRVYVVDLPACGRSNSLTAGQLLVANQSAV
PSEAIVARDVTATASQTQEGWDTARLHTQWPGSGQSGDAIFDRYYASLVPLLLRKADRQKLAQSALSSLLDETGP
AILIGEGSGATMAWLAADAKPQQVAAVMAIEPAGPPCGTARSQQQQQQQQPDISCHHHHRRFSPQIRLDRQVRAW
GLADIPMQFDPPVKAPADLDVIATLALGHQGTCAMQACAENSWPRQAPGPPPTPRRLTNLETMPHLVVTAQASSH
STYDWATVKFLRQAGAKTDSKRLEEYGVLGNGHLMFLEENSDEIACLLCMWIAERFPTVVADV
Coding >Ophio5|4162
ATGCAGATGAGCACCAACAAAAATAACAGCAACGGACCCGAAACGGCCACGCCCCCGTCCGACGACGACGACGCC
AACATCTCGCTCCCTCAACTCGAAGCTCATCTAGCGCCCGTCGGACAGCCGGTTGAAGGCGCCTTCAGCACCCGA
ACCGTCCTCTTCGTCAGGGCCTACTGGGCCGCTGAGGATGGGGAGCAGGAGCGGGCGGGCGGTCACATGTACGTC
GAGCGGCTCGATCCGCTGCTGACGGTTCAGCCGCTGCCCATCATCTTGATTCACGGCGACTGGCACACCGGCCAG
GTCTGGAACACCAAGCCTGATGGCAAGCCCGGCTGGGCGTCCTACTTCAACTACCAGGGCTATCGCGTCTATGTC
GTCGACCTACCGGCTTGCGGGCGCTCCAACTCGTTGACGGCCGGCCAGTTGCTGGTGGCGAATCAATCGGCCGTG
CCCAGTGAAGCCATCGTCGCTCGAGACGTGACGGCCACAGCCAGTCAGACGCAGGAAGGCTGGGACACGGCCCGG
TTGCACACGCAGTGGCCCGGGTCGGGACAGTCGGGCGACGCCATCTTCGACCGCTATTACGCCTCGCTCGTGCCG
CTGCTGCTACGAAAGGCAGACCGACAGAAGCTGGCGCAGAGCGCACTCAGCTCCTTGCTCGACGAGACGGGTCCG
GCCATCCTCATCGGCGAAGGCTCGGGCGCCACCATGGCCTGGCTGGCAGCGGACGCGAAGCCGCAACAGGTAGCG
GCCGTCATGGCCATCGAACCGGCCGGACCTCCCTGCGGCACGGCCCGAAGCCAGCAGCAGCAGCAGCAGCAGCAG
CCAGACATCAGCTGCCACCACCACCATCGACGCTTCTCCCCACAGATCCGTCTCGACCGACAGGTTCGAGCCTGG
GGTCTAGCCGACATCCCCATGCAATTCGACCCGCCCGTCAAAGCTCCGGCCGACCTAGACGTCATAGCGACGCTC
GCCCTAGGCCATCAAGGAACGTGCGCGATGCAGGCGTGTGCGGAAAACTCGTGGCCTCGACAGGCACCCGGACCG
CCGCCCACGCCCCGGCGACTGACGAATCTGGAGACGATGCCGCATCTGGTGGTGACGGCGCAGGCGAGCTCGCAC
TCGACCTACGACTGGGCCACGGTTAAGTTCCTCCGCCAGGCGGGTGCCAAGACGGACAGTAAGCGTCTGGAGGAG
TACGGCGTGTTGGGAAACGGTCATCTCATGTTTCTCGAGGAGAACAGCGATGAGATTGCCTGTCTGCTGTGCATG
TGGATTGCCGAGCGTTTTCCCACCGTCGTCGCCGATGTC
Transcript >Ophio5|4162
ATGCAGATGAGCACCAACAAAAATAACAGCAACGGACCCGAAACGGCCACGCCCCCGTCCGACGACGACGACGCC
AACATCTCGCTCCCTCAACTCGAAGCTCATCTAGCGCCCGTCGGACAGCCGGTTGAAGGCGCCTTCAGCACCCGA
ACCGTCCTCTTCGTCAGGGCCTACTGGGCCGCTGAGGATGGGGAGCAGGAGCGGGCGGGCGGTCACATGTACGTC
GAGCGGCTCGATCCGCTGCTGACGGTTCAGCCGCTGCCCATCATCTTGATTCACGGCGACTGGCACACCGGCCAG
GTCTGGAACACCAAGCCTGATGGCAAGCCCGGCTGGGCGTCCTACTTCAACTACCAGGGCTATCGCGTCTATGTC
GTCGACCTACCGGCTTGCGGGCGCTCCAACTCGTTGACGGCCGGCCAGTTGCTGGTGGCGAATCAATCGGCCGTG
CCCAGTGAAGCCATCGTCGCTCGAGACGTGACGGCCACAGCCAGTCAGACGCAGGAAGGCTGGGACACGGCCCGG
TTGCACACGCAGTGGCCCGGGTCGGGACAGTCGGGCGACGCCATCTTCGACCGCTATTACGCCTCGCTCGTGCCG
CTGCTGCTACGAAAGGCAGACCGACAGAAGCTGGCGCAGAGCGCACTCAGCTCCTTGCTCGACGAGACGGGTCCG
GCCATCCTCATCGGCGAAGGCTCGGGCGCCACCATGGCCTGGCTGGCAGCGGACGCGAAGCCGCAACAGGTAGCG
GCCGTCATGGCCATCGAACCGGCCGGACCTCCCTGCGGCACGGCCCGAAGCCAGCAGCAGCAGCAGCAGCAGCAG
CCAGACATCAGCTGCCACCACCACCATCGACGCTTCTCCCCACAGATCCGTCTCGACCGACAGGTTCGAGCCTGG
GGTCTAGCCGACATCCCCATGCAATTCGACCCGCCCGTCAAAGCTCCGGCCGACCTAGACGTCATAGCGACGCTC
GCCCTAGGCCATCAAGGAACGTGCGCGATGCAGGCGTGTGCGGAAAACTCGTGGCCTCGACAGGCACCCGGACCG
CCGCCCACGCCCCGGCGACTGACGAATCTGGAGACGATGCCGCATCTGGTGGTGACGGCGCAGGCGAGCTCGCAC
TCGACCTACGACTGGGCCACGGTTAAGTTCCTCCGCCAGGCGGGTGCCAAGACGGACAGTAAGCGTCTGGAGGAG
TACGGCGTGTTGGGAAACGGTCATCTCATGTTTCTCGAGGAGAACAGCGATGAGATTGCCTGTCTGCTGTGCATG
TGGATTGCCGAGCGTTTTCCCACCGTCGTCGCCGATGTCTGA
Gene >Ophio5|4162
ATGCAGATGAGCACCAACAAAAATAACAGCAACGGACCCGAAACGGCCACGCCCCCGTCCGACGACGACGACGCC
AACATCTCGCTCCCTCAACTCGAAGCTCATCTAGCGCCCGTCGGACAGCCGGTTGAAGGCGCCTTCAGCACCCGA
ACCGTCCTCTTCGTCAGGGCCTACTGGGCCGCTGAGGATGGGGAGCAGGAGCGGGCGGGCGGTCACATGTACGTC
GAGCGGCTCGATCCGCTGCTGACGGTTCAGCCGCTGCCCATCATCTTGATTCACGGCGACTGGCACACCGGCCAG
GTTTGTTTTGCGGGTTTTGCTGAGCTGTGAAGAAGGATGAGGGATACTGAAACGTGCGTGGCACAGGTCTGGAAC
ACCAAGCCTGATGGCAAGCCCGGCTGGGCGTCCTACTTCAACTACCAGGGCTATCGCGTCTATGTCGTCGACCTA
CCGGCTTGCGGGCGCTCCAACTCGTTGACGGCCGGCCAGTTGCTGGTGGCGAATCAATCGGCCGTGCCCAGTGAA
GCCATCGTCGCTCGAGACGTGACGGCCACAGCCAGTCAGACGCAGGAAGGCTGGGACACGGCCCGGTTGCACACG
CAGTGGCCCGGGGTGAGCATGTTCCAAAGAAAGAGGACGGACGGTGTTGTGAAGGGGGGGGGGGGGGGGAAAAAG
AGACGACTCGGCTAAAAACCCCCTTTTTTTTTTGCCACAGTCGGGACAGTCGGGCGACGCCATCTTCGACCGCTA
TTACGCCTCGCTCGTGCCGCTGCTGCTACGAAAGGCAGACCGACAGAAGCTGGCGCAGAGCGCACTCAGCTCCTT
GCTCGACGAGACGGGTCCGGCCATCCTCATCGGCGAAGGCTCGGGCGCCACCATGGCCTGGCTGGCAGCGGACGC
GAAGCCGCAACAGGTAGCGGCCGTCATGGCCATCGAACCGGCCGGACCTCCCTGCGGCACGGCCCGAAGCCAGCA
GCAGCAGCAGCAGCAGCAGCCAGACATCAGCTGCCACCACCACCATCGACGCTTCTCCCCACAGATCCGTCTCGA
CCGACAGGTTCGAGCCTGGGGTCTAGCCGACATCCCCATGCAATTCGACCCGCCCGTCAAAGCTCCGGCCGACCT
AGACGTCATAGCGACGCTCGCCCTAGGCCATCAAGGAACGTGCGCGATGCAGGCGTGTGCGGAAAACTCGTGGCC
TCGACAGGCACCCGGACCGCCGCCCACGCCCCGGCGACTGACGAATCTGGAGACGATGCCGCATCTGGTGGTGAC
GGCGCAGGCGAGCTCGCACTCGACCTACGACTGGGCCACGGTTAAGTTCCTCCGCCAGGCGGGTGCCAAGACGGA
CAGTAAGCGTCTGGAGGAGTACGGCGTGTTGGGAAACGGTCATCTCATGTTTCTCGAGGAGAACAGCGATGAGAT
TGCCTGTCTGCTGTGCATGTGGATTGCCGAGCGTTTTCCCACCGTCGTCGCCGATGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail