Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4161
Gene name
Locationscaffold_327:18425..19411
Strand-
Gene length (bp)986
Transcript length (bp)831
Coding sequence length (bp)828
Protein length (aa) 276

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01988 VIT1 VIT family 1.2E-56 34 249

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6MWE5|VIT11_ORYSJ Vacuolar iron transporter 1.1 OS=Oryza sativa subsp. japonica GN=VIT1.1 PE=2 SV=1 30 252 2.0E-37
sp|Q6ERE5|VIT12_ORYSJ Vacuolar iron transporter 1.2 OS=Oryza sativa subsp. japonica GN=VIT1.2 PE=3 SV=2 11 253 1.0E-34
sp|Q9ZUA5|VIT1_ARATH Vacuolar iron transporter 1 OS=Arabidopsis thaliana GN=VIT1 PE=2 SV=1 35 252 1.0E-32
sp|P47818|CCC1_YEAST Protein CCC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCC1 PE=1 SV=1 32 222 5.0E-30

GO

GO Term Description Terminal node
GO:0005384 manganese ion transmembrane transporter activity Yes
GO:0030026 cellular manganese ion homeostasis Yes
GO:0009987 cellular process No
GO:0048878 chemical homeostasis No
GO:0008150 biological_process No
GO:0055080 cation homeostasis No
GO:0042592 homeostatic process No
GO:0006875 cellular metal ion homeostasis No
GO:0046915 transition metal ion transmembrane transporter activity No
GO:0065007 biological regulation No
GO:0055076 transition metal ion homeostasis No
GO:0003674 molecular_function No
GO:0065008 regulation of biological quality No
GO:0005215 transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0015075 ion transmembrane transporter activity No
GO:0006873 cellular ion homeostasis No
GO:0030003 cellular cation homeostasis No
GO:0019725 cellular homeostasis No
GO:0055065 metal ion homeostasis No
GO:0046916 cellular transition metal ion homeostasis No
GO:0098771 inorganic ion homeostasis No
GO:0046873 metal ion transmembrane transporter activity No
GO:0008324 cation transmembrane transporter activity No
GO:0050801 ion homeostasis No
GO:0055082 cellular chemical homeostasis No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0055071 manganese ion homeostasis No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

Domain # Start End Length
1 61 83 22
2 166 188 22
3 192 214 22
4 226 248 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4161
MALSSSSPLLRQEDVVREEGEKAGGMNGADTLHHVIIGFSDGVTVPFALTAGLSSLGSSRLVVIGGLADLFSGMI
SMGLGAYLAAVTERDRSRLESREEEEEEAAIVALDDQLCHLLCRRYLLSSDVARVWIHELGRNPVGWQRFCRDVL
TRTDRRDPSSSSRRPCLAGLTMGASYLVGGLIPMLPYFFVARVGHALLLSVVITLLILLAFGYLKDYLAVRSHRA
GCWGALQTLVIGILAAGTSYAIVRALDAAGEPLRLRHAIYRCTSTDSNVRK
Coding >Ophio5|4161
ATGGCCCTCTCATCCTCCTCCCCTCTCCTGCGGCAAGAAGACGTAGTGAGGGAAGAGGGCGAAAAAGCAGGAGGG
ATGAACGGCGCCGACACACTACATCACGTCATCATCGGCTTCTCGGACGGGGTCACGGTACCTTTCGCTCTGACG
GCCGGCCTCTCCTCTCTCGGTAGCAGCCGGCTCGTCGTCATCGGCGGTCTGGCCGATCTCTTCTCCGGAATGATC
AGCATGGGACTCGGCGCTTACCTGGCTGCCGTCACGGAGAGGGATCGCTCTCGGCTGGAGAGTAGGGAGGAGGAG
GAGGAGGAGGCGGCGATCGTGGCTCTTGATGACCAGCTTTGTCACCTCTTGTGTCGTCGCTATCTGCTTTCCTCT
GACGTCGCTAGGGTCTGGATCCATGAGCTGGGTCGGAATCCTGTTGGTTGGCAACGCTTTTGCCGAGATGTGTTG
ACGAGAACGGATCGTCGTGATCCGTCGAGCAGCAGTCGTCGTCCTTGTCTGGCTGGTCTGACCATGGGAGCCAGC
TACTTGGTCGGCGGCCTCATTCCCATGCTTCCTTACTTCTTCGTCGCTCGCGTCGGACACGCTCTGCTCCTCTCC
GTCGTCATCACCCTCCTCATCCTTCTCGCTTTTGGCTACCTCAAGGATTATCTCGCTGTCCGGAGTCACCGTGCT
GGCTGCTGGGGCGCGCTTCAGACGCTGGTCATTGGCATCTTGGCTGCCGGTACGAGCTACGCCATTGTCCGGGCG
CTGGATGCGGCCGGCGAGCCTCTTCGGTTGAGACATGCCATCTATAGATGCACATCAACGGATAGCAATGTTCGC
AAG
Transcript >Ophio5|4161
ATGGCCCTCTCATCCTCCTCCCCTCTCCTGCGGCAAGAAGACGTAGTGAGGGAAGAGGGCGAAAAAGCAGGAGGG
ATGAACGGCGCCGACACACTACATCACGTCATCATCGGCTTCTCGGACGGGGTCACGGTACCTTTCGCTCTGACG
GCCGGCCTCTCCTCTCTCGGTAGCAGCCGGCTCGTCGTCATCGGCGGTCTGGCCGATCTCTTCTCCGGAATGATC
AGCATGGGACTCGGCGCTTACCTGGCTGCCGTCACGGAGAGGGATCGCTCTCGGCTGGAGAGTAGGGAGGAGGAG
GAGGAGGAGGCGGCGATCGTGGCTCTTGATGACCAGCTTTGTCACCTCTTGTGTCGTCGCTATCTGCTTTCCTCT
GACGTCGCTAGGGTCTGGATCCATGAGCTGGGTCGGAATCCTGTTGGTTGGCAACGCTTTTGCCGAGATGTGTTG
ACGAGAACGGATCGTCGTGATCCGTCGAGCAGCAGTCGTCGTCCTTGTCTGGCTGGTCTGACCATGGGAGCCAGC
TACTTGGTCGGCGGCCTCATTCCCATGCTTCCTTACTTCTTCGTCGCTCGCGTCGGACACGCTCTGCTCCTCTCC
GTCGTCATCACCCTCCTCATCCTTCTCGCTTTTGGCTACCTCAAGGATTATCTCGCTGTCCGGAGTCACCGTGCT
GGCTGCTGGGGCGCGCTTCAGACGCTGGTCATTGGCATCTTGGCTGCCGGTACGAGCTACGCCATTGTCCGGGCG
CTGGATGCGGCCGGCGAGCCTCTTCGGTTGAGACATGCCATCTATAGATGCACATCAACGGATAGCAATGTTCGC
AAGTAG
Gene >Ophio5|4161
ATGGCCCTCTCATCCTCCTCCCCTCTCCTGCGGCAAGAAGACGTAGTGAGGGAAGAGGGCGAAAAAGCAGGAGGG
ATGAACGGCGCCGACACACTACATCACGTCATCATCGGCTTCTCGGACGGGGTCACGGTACCTTTCGCTCTGACG
GCCGGCCTCTCCTCTCTCGGTAGCAGCCGGCTCGTCGTCATCGGCGGTCTGGCCGATCTCTTCTCCGGAATGATC
AGCATGGGACTCGGCGCTTACCTGGCTGCCGTCACGGAGAGGGATCGCTCTCGGCTGGAGAGTAGGGAGGAGGAG
GAGGAGGAGGCGGCGATCGTGGCTCTTGATGACCAGCTTTGTCACCTCTTGTGTCGTCGCTATCTGCTTTCCTCT
GACGTCGCTAGGGTCTGGATCCATGAGCTGGGTCGGAATCCTGTTGGTTGGCAACGCTTTTGCCGAGATGTGTTG
ACGAGAACGGATCGTCGTGATCCGTCGAGCAGCAGTCGTCGTCCTTGTCTGGCTGGTCTGACCATGGGAGCCAGC
TACTTGGTCGGCGGCCTCATTCCCATGCTTCCTTACTTCTTCGTCGCTCGCGTCGGACACGCTCTGCTCCTCTCC
GTCGTCATCACCCTCCTCATCCTTCTCGCTTTTGGCTACCTCAAGGATTATCTCGCTGTCCGGAGTCACCGTGCT
GGCTGCTGGGGCGCGCTTCAGACGCTGGTCATTGGCATCTTGGCTGCCGGTACGAGCTACGCCATTGTCCGGGCG
CTGGATGCGGCCGGCGAGCCGTGAGGTCCGATTTTCCCCCGTCTTCTTTCTGCACATTTACCTCTGTTTCATCTT
GTCACGACACCTTATCTTCTTGTGTTGAAAAGTCTTCGGTTGAGACATGGTGAGCAAGGCGTCTGGAGCCGCGAG
GCAAATCATGGCTTTCGTCTGAACTATGAGCACGGCGGGAAGCCATCTATAGATGCACATCAACGGATAGCAATG
TTCGCAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail