Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4160
Gene name
Locationscaffold_327:15439..18142
Strand+
Gene length (bp)2703
Transcript length (bp)2703
Coding sequence length (bp)2700
Protein length (aa) 900

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00569 ZZ Zinc finger, ZZ type 1.3E-09 133 168
PF13202 EF-hand_5 EF hand 5.4E-03 278 297

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HAE3|EFCB1_HUMAN EF-hand calcium-binding domain-containing protein 1 OS=Homo sapiens GN=EFCAB1 PE=2 SV=1 249 396 7.0E-10
sp|Q9D3N2|EFCB1_MOUSE EF-hand calcium-binding domain-containing protein 1 OS=Mus musculus GN=Efcab1 PE=2 SV=1 252 396 1.0E-09
sp|Q24629|REF2P_DROSI Protein ref(2)P OS=Drosophila simulans GN=ref(2)P PE=3 SV=1 129 180 3.0E-08
sp|Q32L26|EFCB1_BOVIN EF-hand calcium-binding domain-containing protein 1 OS=Bos taurus GN=EFCAB1 PE=2 SV=1 251 396 6.0E-08
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 132 184 6.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HAE3|EFCB1_HUMAN EF-hand calcium-binding domain-containing protein 1 OS=Homo sapiens GN=EFCAB1 PE=2 SV=1 249 396 7.0E-10
sp|Q9D3N2|EFCB1_MOUSE EF-hand calcium-binding domain-containing protein 1 OS=Mus musculus GN=Efcab1 PE=2 SV=1 252 396 1.0E-09
sp|Q24629|REF2P_DROSI Protein ref(2)P OS=Drosophila simulans GN=ref(2)P PE=3 SV=1 129 180 3.0E-08
sp|Q32L26|EFCB1_BOVIN EF-hand calcium-binding domain-containing protein 1 OS=Bos taurus GN=EFCAB1 PE=2 SV=1 251 396 6.0E-08
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 132 184 6.0E-08
sp|Q7FRS8|CNBLA_ARATH Calcineurin B-like protein 10 OS=Arabidopsis thaliana GN=CBL10 PE=1 SV=1 204 362 1.0E-07
sp|P14199|REF2P_DROME Protein ref(2)P OS=Drosophila melanogaster GN=ref(2)P PE=1 SV=2 129 180 4.0E-07
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 132 184 4.0E-07
sp|Q3YLA4|NCS1_LYMST Neuronal calcium sensor 1 OS=Lymnaea stagnalis PE=2 SV=2 273 338 5.0E-07
sp|Q16981|NCS1_APLCA Neuronal calcium sensor 1 OS=Aplysia californica PE=2 SV=2 273 338 5.0E-07
sp|Q3KQ77|EFCB1_XENLA EF-hand calcium-binding domain-containing protein 1 OS=Xenopus laevis GN=efcab1 PE=2 SV=1 252 354 8.0E-07
sp|Q86A72|Y4781_DICDI Recoverin family protein DDB_G0274781 OS=Dictyostelium discoideum GN=DDB_G0274781 PE=3 SV=1 212 339 2.0E-06
sp|Q804S5|MIB1_DANRE E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 130 184 3.0E-06
sp|P42325|NCAH_DROME Neurocalcin homolog OS=Drosophila melanogaster GN=Nca PE=1 SV=2 278 346 3.0E-06
sp|Q75K28|NCSA_DICDI Calcium-binding protein NCSA OS=Dictyostelium discoideum GN=ncsA PE=1 SV=2 207 340 3.0E-06
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 130 192 5.0E-06
sp|Q16982|NECX_APLCA Neurocalcin OS=Aplysia californica PE=2 SV=2 278 346 6.0E-06
sp|Q5RC90|NCS1_PONAB Neuronal calcium sensor 1 OS=Pongo abelii GN=NCS1 PE=2 SV=3 280 338 6.0E-06
sp|Q8BNY6|NCS1_MOUSE Neuronal calcium sensor 1 OS=Mus musculus GN=Ncs1 PE=1 SV=3 280 338 6.0E-06
sp|P62167|NCS1_CHICK Neuronal calcium sensor 1 OS=Gallus gallus GN=NCS1 PE=1 SV=2 280 338 6.0E-06
sp|P62166|NCS1_HUMAN Neuronal calcium sensor 1 OS=Homo sapiens GN=NCS1 PE=1 SV=2 280 338 6.0E-06
sp|P62168|NCS1_RAT Neuronal calcium sensor 1 OS=Rattus norvegicus GN=Ncs1 PE=1 SV=2 280 338 6.0E-06
sp|Q91614|NCS1_XENLA Neuronal calcium sensor 1 OS=Xenopus laevis GN=ncs1 PE=2 SV=2 280 338 6.0E-06
sp|Q5R632|HPCL1_PONAB Hippocalcin-like protein 1 OS=Pongo abelii GN=HPCAL1 PE=2 SV=3 278 346 8.0E-06
sp|P62759|NCALD_TAEGU Neurocalcin-delta OS=Taeniopygia guttata GN=NCALD PE=2 SV=2 278 346 9.0E-06
sp|P62758|NCALD_CHICK Neurocalcin-delta OS=Gallus gallus GN=NCALD PE=2 SV=2 278 346 9.0E-06
sp|P62749|HPCL1_RAT Hippocalcin-like protein 1 OS=Rattus norvegicus GN=Hpcal1 PE=1 SV=2 278 346 9.0E-06
sp|P62748|HPCL1_MOUSE Hippocalcin-like protein 1 OS=Mus musculus GN=Hpcal1 PE=1 SV=2 278 346 9.0E-06
sp|B3DLU1|NCALD_XENTR Neurocalcin-delta OS=Xenopus tropicalis GN=ncald PE=2 SV=1 278 346 9.0E-06
sp|Q7SY75|NCALD_XENLA Neurocalcin-delta OS=Xenopus laevis GN=ncald PE=2 SV=1 278 346 1.0E-05
sp|Q5PQN0|NCALD_RAT Neurocalcin-delta OS=Rattus norvegicus GN=Ncald PE=1 SV=3 278 346 1.0E-05
sp|Q91X97|NCALD_MOUSE Neurocalcin-delta OS=Mus musculus GN=Ncald PE=1 SV=4 278 346 1.0E-05
sp|Q4R4N4|NCALD_MACFA Neurocalcin-delta OS=Macaca fascicularis GN=NCALD PE=2 SV=3 278 346 1.0E-05
sp|P61601|NCALD_HUMAN Neurocalcin-delta OS=Homo sapiens GN=NCALD PE=1 SV=2 278 346 1.0E-05
sp|P61602|NCALD_BOVIN Neurocalcin-delta OS=Bos taurus GN=NCALD PE=1 SV=2 278 346 1.0E-05
sp|Q80SY4|MIB1_MOUSE E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 130 184 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0046914 transition metal ion binding No
GO:0046872 metal ion binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 16 38 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 64.25 34.13 94.36
CcL In ants, during behavior modification 55.18 28.60 81.75
CcD In ants, recently dead 74.19 38.73 109.65

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.563553 no
SC16a CcD 0.581765 no
CcL CcD 0.235608 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4160
MWPSTPSVETLTRPRLAVAVISTFAAVSACYLVFQSSWSADRSGIGALHRSNAVRRTRRRDLADSSSSSEAEGDE
NLQLDNIAVEVETVVDVGADEWWNDLAGFQPSQRAGHNIVSLLFRVSEDNARRNGCVHRGCQCNACGMVPIRGVR
YRCANCADFDLCETCEAQGIHIRTHIFYKIRVPAPPFGPRQMQPVWYTGDPDTCRRSLPRGLIAKLSRDTGFERP
ELEAFWEQWTFMAFSEWREDPDDLGVAMDRRTFERCLVPTGGSRHAAPNLIHDRMFSFYDANNDGLISFAEFLHG
LSYRKRKDKLRKVFEGYDIDGDGFVNRRDFLRMFRAYYVLYKQMHKDILDGLEDQLLASADAAGVVHSRQPLSSL
FGREGRVPPADSGMRFEGKTFHRDGTVVVDDGHHGTTIESRGDTATREDILTSLFAYETLQQPRRRFVAQRDTDT
NWRTVRRLSANDADRAYWVTLLDPPDSLDELPDVLTGANLRDVEETDDEADDEADVDGRGHGGEDGGDGAEGRWR
ADGGLGTDSERRAAMLSRARRQAPKMEKRRRDMARSQLHERWRRRQFYLDEEEGGLAPDDWDKDEDVLAKLSMAV
EEAQTAAQTRSRSSSKVRFAEDMDDYDTRSNPSTSSRSMPERWGGMGVPDAERDAGKEILYQVTQQAFNELLDTI
FKPAEDLAVEAAETKERRERFRSAVEAVDSVDEAENKAKTPDARPASDRVKRDKSTEDAVSTVLTNMDMLERRNA
VDLDYPANLSEYSISPASSVSGDDEPAEYRDPTMPQFRPNAVPPTKKEKEDKKKKKKKSQQQQQQQQQPKPKRSE
TDSDSGSSSTRSSGSEPSVATLRRWKQLDEAETKAATRGGWGRLSFDEFEAIYKNQEDQGNRLDYLGSWIDFCIP
Coding >Ophio5|4160
ATGTGGCCGTCGACTCCCTCGGTCGAGACGCTGACTCGGCCGCGACTGGCCGTGGCCGTCATCTCGACCTTCGCC
GCCGTTTCTGCCTGTTACCTCGTCTTTCAGTCAAGCTGGTCGGCCGATCGGTCCGGCATCGGAGCCTTACATAGA
AGCAACGCCGTGAGACGCACCCGACGCCGGGACTTGGCCGATTCCAGCTCGTCTTCCGAGGCGGAAGGCGATGAG
AATCTCCAGTTGGACAATATCGCCGTCGAAGTCGAGACCGTGGTCGATGTTGGCGCCGATGAGTGGTGGAATGAT
CTGGCCGGCTTCCAGCCGTCGCAGCGCGCTGGTCACAACATCGTGAGCCTGCTGTTTCGCGTCTCCGAGGATAAC
GCGCGTCGCAACGGCTGCGTTCATCGTGGGTGCCAGTGCAACGCCTGCGGCATGGTGCCCATCCGCGGCGTGCGC
TATCGCTGCGCAAACTGCGCCGACTTCGACCTATGCGAGACGTGTGAGGCTCAGGGCATTCACATCAGGACGCAC
ATCTTCTACAAGATCAGGGTTCCGGCTCCGCCCTTTGGGCCCCGCCAGATGCAGCCCGTCTGGTATACGGGCGAT
CCCGACACCTGTCGCCGCAGTCTGCCTCGCGGCCTCATCGCCAAGTTGTCGCGCGACACGGGCTTCGAGCGGCCC
GAGCTGGAGGCCTTTTGGGAGCAGTGGACCTTTATGGCCTTTTCCGAGTGGCGCGAGGATCCGGACGACCTCGGC
GTGGCCATGGATCGGAGGACGTTTGAGCGCTGCCTCGTGCCCACCGGCGGCTCGCGTCACGCGGCTCCCAACCTC
ATCCACGACCGCATGTTCTCCTTTTACGACGCCAACAACGACGGGCTCATCAGCTTTGCCGAGTTTCTTCACGGC
CTGTCGTATCGGAAGCGCAAGGACAAGCTGCGCAAGGTCTTTGAGGGCTACGACATTGACGGCGACGGCTTCGTC
AACAGACGAGACTTTCTCCGCATGTTCCGCGCCTACTATGTCCTGTACAAGCAGATGCACAAGGACATTCTCGAT
GGGCTCGAGGATCAGCTGCTGGCCAGCGCCGATGCCGCCGGCGTCGTCCACAGCCGCCAACCGCTCAGCAGCCTG
TTCGGCCGCGAGGGTAGAGTGCCTCCCGCCGACAGCGGCATGCGCTTCGAGGGAAAGACGTTTCACCGCGACGGG
ACTGTCGTCGTCGACGACGGACATCACGGGACCACCATCGAGAGCCGCGGCGACACGGCGACGCGCGAGGACATC
CTGACGAGCCTCTTCGCTTACGAGACGCTCCAGCAGCCGCGCCGCCGATTCGTGGCCCAGCGCGACACCGACACG
AATTGGCGCACCGTTAGGCGCCTGAGCGCCAACGACGCCGACCGCGCCTACTGGGTCACGCTCCTGGATCCGCCG
GACTCGCTCGACGAGCTGCCCGACGTCCTGACGGGCGCCAACTTACGGGACGTGGAAGAGACGGACGACGAGGCC
GACGACGAGGCCGACGTCGACGGCCGCGGCCACGGGGGCGAAGATGGCGGCGACGGCGCCGAGGGCCGATGGAGG
GCCGACGGCGGGCTGGGAACCGACAGCGAGCGCCGGGCCGCGATGCTATCCCGCGCGCGGCGCCAGGCGCCCAAG
ATGGAGAAGCGGCGGCGAGACATGGCGCGCAGCCAGCTGCACGAGAGGTGGAGGAGACGTCAGTTCTACCTCGAC
GAGGAGGAGGGCGGCCTGGCCCCGGACGACTGGGACAAGGACGAGGACGTGCTGGCCAAGCTCAGCATGGCGGTC
GAGGAAGCGCAGACGGCGGCCCAGACGCGCTCGCGCTCGAGCTCCAAGGTGCGCTTCGCCGAGGACATGGACGAC
TACGACACGCGATCCAACCCGTCGACGTCGTCGCGGAGCATGCCAGAACGGTGGGGGGGCATGGGCGTGCCGGAC
GCCGAGAGGGACGCCGGCAAGGAGATTCTGTACCAGGTGACGCAGCAGGCCTTCAACGAGCTGCTCGACACCATC
TTCAAGCCGGCCGAGGACTTGGCCGTCGAGGCGGCCGAGACCAAGGAGCGGCGCGAGAGGTTCCGATCTGCCGTC
GAGGCCGTCGATAGCGTCGACGAGGCGGAGAACAAGGCCAAGACACCTGACGCGCGCCCGGCTTCGGACAGGGTC
AAGCGGGACAAGAGCACGGAAGACGCCGTGTCGACCGTGTTGACGAACATGGACATGCTGGAGCGGCGCAACGCC
GTGGACCTCGATTACCCGGCCAACCTGTCCGAGTACTCCATCTCCCCAGCATCTTCCGTCTCGGGAGACGACGAG
CCGGCCGAGTACCGCGACCCGACGATGCCTCAGTTCCGGCCCAACGCGGTCCCACCGACGAAAAAGGAGAAGGAG
GACAAGAAGAAGAAAAAGAAGAAGTCACAGCAACAGCAACAGCAACAGCAACAGCCAAAGCCAAAGCGGAGTGAG
ACCGACTCCGATTCCGGCTCGTCGTCGACGCGCTCGTCCGGCAGCGAGCCGTCGGTGGCGACGCTGCGGCGGTGG
AAGCAGCTGGACGAGGCGGAGACCAAGGCTGCGACCCGGGGCGGCTGGGGGAGGCTCAGCTTCGATGAGTTTGAG
GCCATCTATAAGAATCAGGAGGATCAGGGGAACAGGCTGGACTATCTGGGCAGCTGGATTGACTTTTGCATTCCT
Transcript >Ophio5|4160
ATGTGGCCGTCGACTCCCTCGGTCGAGACGCTGACTCGGCCGCGACTGGCCGTGGCCGTCATCTCGACCTTCGCC
GCCGTTTCTGCCTGTTACCTCGTCTTTCAGTCAAGCTGGTCGGCCGATCGGTCCGGCATCGGAGCCTTACATAGA
AGCAACGCCGTGAGACGCACCCGACGCCGGGACTTGGCCGATTCCAGCTCGTCTTCCGAGGCGGAAGGCGATGAG
AATCTCCAGTTGGACAATATCGCCGTCGAAGTCGAGACCGTGGTCGATGTTGGCGCCGATGAGTGGTGGAATGAT
CTGGCCGGCTTCCAGCCGTCGCAGCGCGCTGGTCACAACATCGTGAGCCTGCTGTTTCGCGTCTCCGAGGATAAC
GCGCGTCGCAACGGCTGCGTTCATCGTGGGTGCCAGTGCAACGCCTGCGGCATGGTGCCCATCCGCGGCGTGCGC
TATCGCTGCGCAAACTGCGCCGACTTCGACCTATGCGAGACGTGTGAGGCTCAGGGCATTCACATCAGGACGCAC
ATCTTCTACAAGATCAGGGTTCCGGCTCCGCCCTTTGGGCCCCGCCAGATGCAGCCCGTCTGGTATACGGGCGAT
CCCGACACCTGTCGCCGCAGTCTGCCTCGCGGCCTCATCGCCAAGTTGTCGCGCGACACGGGCTTCGAGCGGCCC
GAGCTGGAGGCCTTTTGGGAGCAGTGGACCTTTATGGCCTTTTCCGAGTGGCGCGAGGATCCGGACGACCTCGGC
GTGGCCATGGATCGGAGGACGTTTGAGCGCTGCCTCGTGCCCACCGGCGGCTCGCGTCACGCGGCTCCCAACCTC
ATCCACGACCGCATGTTCTCCTTTTACGACGCCAACAACGACGGGCTCATCAGCTTTGCCGAGTTTCTTCACGGC
CTGTCGTATCGGAAGCGCAAGGACAAGCTGCGCAAGGTCTTTGAGGGCTACGACATTGACGGCGACGGCTTCGTC
AACAGACGAGACTTTCTCCGCATGTTCCGCGCCTACTATGTCCTGTACAAGCAGATGCACAAGGACATTCTCGAT
GGGCTCGAGGATCAGCTGCTGGCCAGCGCCGATGCCGCCGGCGTCGTCCACAGCCGCCAACCGCTCAGCAGCCTG
TTCGGCCGCGAGGGTAGAGTGCCTCCCGCCGACAGCGGCATGCGCTTCGAGGGAAAGACGTTTCACCGCGACGGG
ACTGTCGTCGTCGACGACGGACATCACGGGACCACCATCGAGAGCCGCGGCGACACGGCGACGCGCGAGGACATC
CTGACGAGCCTCTTCGCTTACGAGACGCTCCAGCAGCCGCGCCGCCGATTCGTGGCCCAGCGCGACACCGACACG
AATTGGCGCACCGTTAGGCGCCTGAGCGCCAACGACGCCGACCGCGCCTACTGGGTCACGCTCCTGGATCCGCCG
GACTCGCTCGACGAGCTGCCCGACGTCCTGACGGGCGCCAACTTACGGGACGTGGAAGAGACGGACGACGAGGCC
GACGACGAGGCCGACGTCGACGGCCGCGGCCACGGGGGCGAAGATGGCGGCGACGGCGCCGAGGGCCGATGGAGG
GCCGACGGCGGGCTGGGAACCGACAGCGAGCGCCGGGCCGCGATGCTATCCCGCGCGCGGCGCCAGGCGCCCAAG
ATGGAGAAGCGGCGGCGAGACATGGCGCGCAGCCAGCTGCACGAGAGGTGGAGGAGACGTCAGTTCTACCTCGAC
GAGGAGGAGGGCGGCCTGGCCCCGGACGACTGGGACAAGGACGAGGACGTGCTGGCCAAGCTCAGCATGGCGGTC
GAGGAAGCGCAGACGGCGGCCCAGACGCGCTCGCGCTCGAGCTCCAAGGTGCGCTTCGCCGAGGACATGGACGAC
TACGACACGCGATCCAACCCGTCGACGTCGTCGCGGAGCATGCCAGAACGGTGGGGGGGCATGGGCGTGCCGGAC
GCCGAGAGGGACGCCGGCAAGGAGATTCTGTACCAGGTGACGCAGCAGGCCTTCAACGAGCTGCTCGACACCATC
TTCAAGCCGGCCGAGGACTTGGCCGTCGAGGCGGCCGAGACCAAGGAGCGGCGCGAGAGGTTCCGATCTGCCGTC
GAGGCCGTCGATAGCGTCGACGAGGCGGAGAACAAGGCCAAGACACCTGACGCGCGCCCGGCTTCGGACAGGGTC
AAGCGGGACAAGAGCACGGAAGACGCCGTGTCGACCGTGTTGACGAACATGGACATGCTGGAGCGGCGCAACGCC
GTGGACCTCGATTACCCGGCCAACCTGTCCGAGTACTCCATCTCCCCAGCATCTTCCGTCTCGGGAGACGACGAG
CCGGCCGAGTACCGCGACCCGACGATGCCTCAGTTCCGGCCCAACGCGGTCCCACCGACGAAAAAGGAGAAGGAG
GACAAGAAGAAGAAAAAGAAGAAGTCACAGCAACAGCAACAGCAACAGCAACAGCCAAAGCCAAAGCGGAGTGAG
ACCGACTCCGATTCCGGCTCGTCGTCGACGCGCTCGTCCGGCAGCGAGCCGTCGGTGGCGACGCTGCGGCGGTGG
AAGCAGCTGGACGAGGCGGAGACCAAGGCTGCGACCCGGGGCGGCTGGGGGAGGCTCAGCTTCGATGAGTTTGAG
GCCATCTATAAGAATCAGGAGGATCAGGGGAACAGGCTGGACTATCTGGGCAGCTGGATTGACTTTTGCATTCCT
TAG
Gene >Ophio5|4160
ATGTGGCCGTCGACTCCCTCGGTCGAGACGCTGACTCGGCCGCGACTGGCCGTGGCCGTCATCTCGACCTTCGCC
GCCGTTTCTGCCTGTTACCTCGTCTTTCAGTCAAGCTGGTCGGCCGATCGGTCCGGCATCGGAGCCTTACATAGA
AGCAACGCCGTGAGACGCACCCGACGCCGGGACTTGGCCGATTCCAGCTCGTCTTCCGAGGCGGAAGGCGATGAG
AATCTCCAGTTGGACAATATCGCCGTCGAAGTCGAGACCGTGGTCGATGTTGGCGCCGATGAGTGGTGGAATGAT
CTGGCCGGCTTCCAGCCGTCGCAGCGCGCTGGTCACAACATCGTGAGCCTGCTGTTTCGCGTCTCCGAGGATAAC
GCGCGTCGCAACGGCTGCGTTCATCGTGGGTGCCAGTGCAACGCCTGCGGCATGGTGCCCATCCGCGGCGTGCGC
TATCGCTGCGCAAACTGCGCCGACTTCGACCTATGCGAGACGTGTGAGGCTCAGGGCATTCACATCAGGACGCAC
ATCTTCTACAAGATCAGGGTTCCGGCTCCGCCCTTTGGGCCCCGCCAGATGCAGCCCGTCTGGTATACGGGCGAT
CCCGACACCTGTCGCCGCAGTCTGCCTCGCGGCCTCATCGCCAAGTTGTCGCGCGACACGGGCTTCGAGCGGCCC
GAGCTGGAGGCCTTTTGGGAGCAGTGGACCTTTATGGCCTTTTCCGAGTGGCGCGAGGATCCGGACGACCTCGGC
GTGGCCATGGATCGGAGGACGTTTGAGCGCTGCCTCGTGCCCACCGGCGGCTCGCGTCACGCGGCTCCCAACCTC
ATCCACGACCGCATGTTCTCCTTTTACGACGCCAACAACGACGGGCTCATCAGCTTTGCCGAGTTTCTTCACGGC
CTGTCGTATCGGAAGCGCAAGGACAAGCTGCGCAAGGTCTTTGAGGGCTACGACATTGACGGCGACGGCTTCGTC
AACAGACGAGACTTTCTCCGCATGTTCCGCGCCTACTATGTCCTGTACAAGCAGATGCACAAGGACATTCTCGAT
GGGCTCGAGGATCAGCTGCTGGCCAGCGCCGATGCCGCCGGCGTCGTCCACAGCCGCCAACCGCTCAGCAGCCTG
TTCGGCCGCGAGGGTAGAGTGCCTCCCGCCGACAGCGGCATGCGCTTCGAGGGAAAGACGTTTCACCGCGACGGG
ACTGTCGTCGTCGACGACGGACATCACGGGACCACCATCGAGAGCCGCGGCGACACGGCGACGCGCGAGGACATC
CTGACGAGCCTCTTCGCTTACGAGACGCTCCAGCAGCCGCGCCGCCGATTCGTGGCCCAGCGCGACACCGACACG
AATTGGCGCACCGTTAGGCGCCTGAGCGCCAACGACGCCGACCGCGCCTACTGGGTCACGCTCCTGGATCCGCCG
GACTCGCTCGACGAGCTGCCCGACGTCCTGACGGGCGCCAACTTACGGGACGTGGAAGAGACGGACGACGAGGCC
GACGACGAGGCCGACGTCGACGGCCGCGGCCACGGGGGCGAAGATGGCGGCGACGGCGCCGAGGGCCGATGGAGG
GCCGACGGCGGGCTGGGAACCGACAGCGAGCGCCGGGCCGCGATGCTATCCCGCGCGCGGCGCCAGGCGCCCAAG
ATGGAGAAGCGGCGGCGAGACATGGCGCGCAGCCAGCTGCACGAGAGGTGGAGGAGACGTCAGTTCTACCTCGAC
GAGGAGGAGGGCGGCCTGGCCCCGGACGACTGGGACAAGGACGAGGACGTGCTGGCCAAGCTCAGCATGGCGGTC
GAGGAAGCGCAGACGGCGGCCCAGACGCGCTCGCGCTCGAGCTCCAAGGTGCGCTTCGCCGAGGACATGGACGAC
TACGACACGCGATCCAACCCGTCGACGTCGTCGCGGAGCATGCCAGAACGGTGGGGGGGCATGGGCGTGCCGGAC
GCCGAGAGGGACGCCGGCAAGGAGATTCTGTACCAGGTGACGCAGCAGGCCTTCAACGAGCTGCTCGACACCATC
TTCAAGCCGGCCGAGGACTTGGCCGTCGAGGCGGCCGAGACCAAGGAGCGGCGCGAGAGGTTCCGATCTGCCGTC
GAGGCCGTCGATAGCGTCGACGAGGCGGAGAACAAGGCCAAGACACCTGACGCGCGCCCGGCTTCGGACAGGGTC
AAGCGGGACAAGAGCACGGAAGACGCCGTGTCGACCGTGTTGACGAACATGGACATGCTGGAGCGGCGCAACGCC
GTGGACCTCGATTACCCGGCCAACCTGTCCGAGTACTCCATCTCCCCAGCATCTTCCGTCTCGGGAGACGACGAG
CCGGCCGAGTACCGCGACCCGACGATGCCTCAGTTCCGGCCCAACGCGGTCCCACCGACGAAAAAGGAGAAGGAG
GACAAGAAGAAGAAAAAGAAGAAGTCACAGCAACAGCAACAGCAACAGCAACAGCCAAAGCCAAAGCGGAGTGAG
ACCGACTCCGATTCCGGCTCGTCGTCGACGCGCTCGTCCGGCAGCGAGCCGTCGGTGGCGACGCTGCGGCGGTGG
AAGCAGCTGGACGAGGCGGAGACCAAGGCTGCGACCCGGGGCGGCTGGGGGAGGCTCAGCTTCGATGAGTTTGAG
GCCATCTATAAGAATCAGGAGGATCAGGGGAACAGGCTGGACTATCTGGGCAGCTGGATTGACTTTTGCATTCCT
TAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail