Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4156
Gene name
Locationscaffold_327:8865..10235
Strand-
Gene length (bp)1370
Transcript length (bp)1140
Coding sequence length (bp)1137
Protein length (aa) 379

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 2.57 0.39 4.75
CcL In ants, during behavior modification 2.05 0.13 3.97
CcD In ants, recently dead 1.16 0.00 2.36

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.656620 no
SC16a CcD 0.094688 no
CcL CcD 0.272362 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4156
MLRCSFFLLLTLLLGSGSLAESNVLLGSGSLAKSNVLLGNGSLAKSNVIHDLCPRGIAMAGDGGDVTRPPPIIPP
PPNTLKPNNTAPIQSDNTLPQDNSTLHMDNVNPTGNSTLSLDSQMFSAKNSTSSADNSTSSADNSTSSPTQSGTR
LKDNSTVSVEDLEPPATNSTEAEFDPVEYYSDIQPKEEPIRGLDTPDKPLFPPHAARQQYPRLLGVLLREMADSS
WRLHNLVLRQENSTTHISALAWQGLADRFPFPPDAPLTIGEYHDALEKQRVAAKQMLVWKQNADVWNGIYVDVFH
LIRSYIGILGLALNPISGVKPPMHLLDLPWYTFEALVALVIWDNTMLLNVTWRGQELKPFFRWPRRVYVRQPGVD
FGPW
Coding >Ophio5|4156
ATGCTGAGGTGCAGCTTTTTCCTGCTTCTGACGCTGCTCTTGGGCAGCGGCAGTCTAGCGGAGTCGAATGTGCTC
TTGGGCAGCGGCAGTCTAGCGAAGTCGAATGTGCTCTTGGGCAACGGCAGTCTAGCGAAGTCGAACGTCATCCAT
GACCTGTGCCCCCGGGGTATCGCGATGGCGGGTGATGGCGGGGATGTCACCAGGCCTCCCCCCATCATCCCGCCT
CCACCGAACACATTGAAGCCGAATAACACTGCGCCAATTCAAAGTGATAATACTCTCCCCCAGGACAACTCGACT
CTCCACATGGACAACGTGAATCCCACCGGCAACTCGACTCTGTCCTTGGACAGCCAGATGTTCTCCGCGAAAAAC
TCGACTTCCTCGGCGGACAACTCGACTTCCTCGGCGGACAACTCAACTTCTTCCCCGACCCAATCAGGAACTCGC
CTCAAGGACAACTCGACTGTTTCCGTCGAAGACTTGGAACCCCCTGCGACCAACTCGACCGAAGCTGAATTCGAC
CCGGTCGAATACTACTCAGACATCCAACCCAAGGAGGAACCCATCCGCGGCCTCGACACCCCAGACAAGCCCCTC
TTCCCCCCGCACGCAGCCCGACAGCAATACCCCAGACTTCTCGGCGTTCTGCTCCGCGAAATGGCCGACAGCTCA
TGGCGTCTGCACAATCTCGTCCTCCGCCAGGAAAACAGCACCACCCACATATCTGCCCTGGCATGGCAGGGCCTC
GCCGATAGATTTCCATTCCCCCCCGATGCTCCGTTGACCATTGGTGAATACCACGATGCCCTTGAAAAGCAACGT
GTAGCGGCGAAACAGATGCTGGTTTGGAAGCAGAACGCCGACGTATGGAACGGCATCTATGTCGATGTGTTCCAC
CTCATCAGGTCCTACATCGGAATACTAGGCCTCGCGCTCAATCCTATTTCCGGCGTTAAACCCCCGATGCACCTG
CTCGACCTCCCATGGTACACTTTCGAGGCGCTGGTAGCCCTCGTCATCTGGGACAACACGATGCTGCTCAACGTC
ACCTGGCGTGGACAGGAACTGAAACCTTTCTTTCGATGGCCTCGGAGGGTGTATGTCAGACAGCCCGGCGTCGAT
TTTGGTCCTTGG
Transcript >Ophio5|4156
ATGCTGAGGTGCAGCTTTTTCCTGCTTCTGACGCTGCTCTTGGGCAGCGGCAGTCTAGCGGAGTCGAATGTGCTC
TTGGGCAGCGGCAGTCTAGCGAAGTCGAATGTGCTCTTGGGCAACGGCAGTCTAGCGAAGTCGAACGTCATCCAT
GACCTGTGCCCCCGGGGTATCGCGATGGCGGGTGATGGCGGGGATGTCACCAGGCCTCCCCCCATCATCCCGCCT
CCACCGAACACATTGAAGCCGAATAACACTGCGCCAATTCAAAGTGATAATACTCTCCCCCAGGACAACTCGACT
CTCCACATGGACAACGTGAATCCCACCGGCAACTCGACTCTGTCCTTGGACAGCCAGATGTTCTCCGCGAAAAAC
TCGACTTCCTCGGCGGACAACTCGACTTCCTCGGCGGACAACTCAACTTCTTCCCCGACCCAATCAGGAACTCGC
CTCAAGGACAACTCGACTGTTTCCGTCGAAGACTTGGAACCCCCTGCGACCAACTCGACCGAAGCTGAATTCGAC
CCGGTCGAATACTACTCAGACATCCAACCCAAGGAGGAACCCATCCGCGGCCTCGACACCCCAGACAAGCCCCTC
TTCCCCCCGCACGCAGCCCGACAGCAATACCCCAGACTTCTCGGCGTTCTGCTCCGCGAAATGGCCGACAGCTCA
TGGCGTCTGCACAATCTCGTCCTCCGCCAGGAAAACAGCACCACCCACATATCTGCCCTGGCATGGCAGGGCCTC
GCCGATAGATTTCCATTCCCCCCCGATGCTCCGTTGACCATTGGTGAATACCACGATGCCCTTGAAAAGCAACGT
GTAGCGGCGAAACAGATGCTGGTTTGGAAGCAGAACGCCGACGTATGGAACGGCATCTATGTCGATGTGTTCCAC
CTCATCAGGTCCTACATCGGAATACTAGGCCTCGCGCTCAATCCTATTTCCGGCGTTAAACCCCCGATGCACCTG
CTCGACCTCCCATGGTACACTTTCGAGGCGCTGGTAGCCCTCGTCATCTGGGACAACACGATGCTGCTCAACGTC
ACCTGGCGTGGACAGGAACTGAAACCTTTCTTTCGATGGCCTCGGAGGGTGTATGTCAGACAGCCCGGCGTCGAT
TTTGGTCCTTGGTGA
Gene >Ophio5|4156
ATGCTGAGGTGCAGCTTTTTCCTGCTTCTGACGCTGCTCTTGGGCAGCGGCAGTCTAGCGGAGTCGAATGTGCTC
TTGGGCAGCGGCAGTCTAGCGAAGTCGAATGTGCTCTTGGGCAACGGCAGTCTAGCGAAGTCGAACGTCATCCAT
GACCTGTGCCCCCGGGGTATCGCGATGGCGGGTGATGGCGGGGATGTCACCAGGCCTCCCCCCATCATCCCGCCT
CCACCGAACACATTGAAGCCGAATAACACTGCGCCAATTCAAAGTGATAATACTCTCCCCCAGGACAACTCGACT
CTCCACATGGACAACGTGAATCCCACCGGCAACTCGACTCTGTCCTTGGACAGCCAGATGTTCTCCGCGAAAAAC
TCGACTTCCTCGGCGGACAACTCGACTTCCTCGGCGGACAACTCAACTTCTTCCCCGACCCAATCAGGAACTCGC
CTCAAGGACAACTCGACTGTTTCCGTCGAAGACTTGGAACCCCCTGCGACCAACTCGACCGAAGCTGAATTCGAC
CCGGTCGAATACTACTCAGACATCCAACCCAAGGAGGAACCCATCCGCGGCCTCGACACCCCAGACAAGCCCCTC
TTCCCCCCGCACGCAGCCCGACAGCAATACCCCAGACTTCTCGGCGTTCTGCTCCGCGAAATGGCCGACAGCTCA
TGGCGTCTGCACAATCTCGTCCTCCGCCAGGAAAACAGCACCACCCACATATCTGCCGTAAGCCTCCTCCTTTTC
CTCTCGTTGAAATGGTTTGAAAATCTTAAAAAAAGAAGAAAAATCAATTAACGCTTGTCTTCCGCGCAGCTGGCA
TGGCAGGGCCTCGCCGATAGATTTCCATTCCCCCCCGATGCTCCGTTGACCATTGGTGAATACCACGATGTATGT
GTCGTCGCCCCCTCCCCCCCCTTATCGGAAAGGAGACAAGTTAAGGGCAGAACAGGCCCTTGAAAAGCAACGTGT
AGCGGCGAAACAGATGCTGGTTTGGAAGCAGAACGCCGACGTATGGAACGGCATCTATGTCGATGTGTTCCACCT
CATCAGGTCCTACATCGTACGCAACTCCGGCCCCTTCTTCCTCCCGGCGGGAGGGAGAGAGAGAAGACGAGTGAA
GCTGACCACCACCACCTCTACAGGGAATACTAGGCCTCGCGCTCAATCCTATTTCCGGCGTTAAACCCCCGATGC
ACCTGCTCGACCTCCCATGGTACACTTTCGAGGCGCTGGTAGCCCTCGTCATCTGGGACAACACGATGCTGCTCA
ACGTCACCTGGCGTGGACAGGAACTGAAACCTTTCTTTCGATGGCCTCGGAGGGTGTATGTCAGACAGCCCGGCG
TCGATTTTGGTCCTTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail