Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4154
Gene name
Locationscaffold_327:3407..5322
Strand-
Gene length (bp)1915
Transcript length (bp)1518
Coding sequence length (bp)1515
Protein length (aa) 505

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 2.0E-12 222 446
PF12146 Hydrolase_4 Serine aminopeptidase, S33 4.3E-10 217 348
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 4.3E-09 219 326

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7Z5M8|AB12B_HUMAN Abhydrolase domain-containing protein 12B OS=Homo sapiens GN=ABHD12B PE=2 SV=1 219 411 1.0E-22
sp|B4F753|ABD12_XENTR Monoacylglycerol lipase ABHD12 OS=Xenopus tropicalis GN=abhd12 PE=2 SV=1 108 410 1.0E-19
sp|Q6AYT7|ABD12_RAT Monoacylglycerol lipase ABHD12 OS=Rattus norvegicus GN=Abhd12 PE=2 SV=1 109 410 2.0E-18
sp|Q99LR1|ABD12_MOUSE Monoacylglycerol lipase ABHD12 OS=Mus musculus GN=Abhd12 PE=1 SV=2 109 410 2.0E-18
sp|Q08C93|ABD12_DANRE Monoacylglycerol lipase ABHD12 OS=Danio rerio GN=abhd12 PE=2 SV=1 109 411 3.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7Z5M8|AB12B_HUMAN Abhydrolase domain-containing protein 12B OS=Homo sapiens GN=ABHD12B PE=2 SV=1 219 411 1.0E-22
sp|B4F753|ABD12_XENTR Monoacylglycerol lipase ABHD12 OS=Xenopus tropicalis GN=abhd12 PE=2 SV=1 108 410 1.0E-19
sp|Q6AYT7|ABD12_RAT Monoacylglycerol lipase ABHD12 OS=Rattus norvegicus GN=Abhd12 PE=2 SV=1 109 410 2.0E-18
sp|Q99LR1|ABD12_MOUSE Monoacylglycerol lipase ABHD12 OS=Mus musculus GN=Abhd12 PE=1 SV=2 109 410 2.0E-18
sp|Q08C93|ABD12_DANRE Monoacylglycerol lipase ABHD12 OS=Danio rerio GN=abhd12 PE=2 SV=1 109 411 3.0E-18
sp|Q4R766|ABD12_MACFA Monoacylglycerol lipase ABHD12 OS=Macaca fascicularis GN=ABHD12 PE=2 SV=1 109 410 3.0E-17
sp|Q8N2K0|ABD12_HUMAN Monoacylglycerol lipase ABHD12 OS=Homo sapiens GN=ABHD12 PE=1 SV=2 109 410 3.0E-17
sp|Q5ZIN0|ABD12_CHICK Monoacylglycerol lipase ABHD12 OS=Gallus gallus GN=ABHD12 PE=2 SV=1 109 411 1.0E-16
sp|Q08DW9|ABD12_BOVIN Monoacylglycerol lipase ABHD12 OS=Bos taurus GN=ABHD12 PE=2 SV=1 115 410 1.0E-16
sp|Q32LS6|ABHDD_DANRE Alpha/beta hydrolase domain-containing protein 13 OS=Danio rerio GN=abhd13 PE=2 SV=1 204 303 8.0E-15
sp|Q6IRP4|ABHDD_XENLA Alpha/beta hydrolase domain-containing protein 13 OS=Xenopus laevis GN=abhd13 PE=2 SV=1 220 314 2.0E-12
sp|Q80UX8|ABHDD_MOUSE Alpha/beta hydrolase domain-containing protein 13 OS=Mus musculus GN=Abhd13 PE=2 SV=1 213 413 1.0E-10
sp|Q8XA81|YHFR_ECO57 Uncharacterized protein YfhR OS=Escherichia coli O157:H7 GN=yhfR PE=3 SV=4 120 409 2.0E-10
sp|Q9KS12|MARTX_VIBCH Multifunctional-autoprocessing repeats-in-toxin OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rtxA PE=1 SV=2 197 350 3.0E-10
sp|Q5ZJL8|ABHDD_CHICK Alpha/beta hydrolase domain-containing protein 13 OS=Gallus gallus GN=ABHD13 PE=2 SV=1 220 314 5.0E-10
sp|P54069|BEM46_SCHPO Protein bem46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bem46 PE=2 SV=3 206 398 2.0E-09
sp|P77538|YFHR_ECOLI Uncharacterized protein YfhR OS=Escherichia coli (strain K12) GN=yfhR PE=3 SV=4 120 409 2.0E-09
sp|Q8Z4M8|YHFR_SALTI Uncharacterized protein YfhR OS=Salmonella typhi GN=yhfR PE=3 SV=1 121 409 3.0E-09
sp|Q7L211|ABHDD_HUMAN Alpha/beta hydrolase domain-containing protein 13 OS=Homo sapiens GN=ABHD13 PE=2 SV=1 213 413 8.0E-09
sp|Q8ZN39|YFHR_SALTY Uncharacterized protein YfhR OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=yfhR PE=3 SV=1 121 409 3.0E-08
sp|Q2HJ19|AB17A_BOVIN Alpha/beta hydrolase domain-containing protein 17A OS=Bos taurus GN=ABHD17A PE=2 SV=1 188 323 1.0E-07
sp|Q5UQK4|YL404_MIMIV Putative alpha/beta hydrolase L404 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L404 PE=3 SV=1 218 414 1.0E-07
sp|Q6AY17|AB17B_RAT Alpha/beta hydrolase domain-containing protein 17B OS=Rattus norvegicus GN=Abhd17b PE=1 SV=1 210 323 2.0E-07
sp|Q7M759|AB17B_MOUSE Alpha/beta hydrolase domain-containing protein 17B OS=Mus musculus GN=Abhd17b PE=1 SV=1 210 323 2.0E-07
sp|Q5ZJX1|AB17C_CHICK Alpha/beta hydrolase domain-containing protein 17C OS=Gallus gallus GN=ABHD17C PE=2 SV=1 166 323 2.0E-07
sp|Q5VST6|AB17B_HUMAN Alpha/beta hydrolase domain-containing protein 17B OS=Homo sapiens GN=ABHD17B PE=1 SV=1 210 323 3.0E-07
sp|Q7ZVZ7|AB17C_DANRE Alpha/beta hydrolase domain-containing protein 17C OS=Danio rerio GN=abhd17c PE=2 SV=1 210 323 5.0E-07
sp|Q8VCV1|AB17C_MOUSE Alpha/beta hydrolase domain-containing protein 17C OS=Mus musculus GN=Abhd17c PE=1 SV=2 210 323 5.0E-07
sp|A5PKD9|AB17C_BOVIN Alpha/beta hydrolase domain-containing protein 17C OS=Bos taurus GN=ABHD17C PE=2 SV=1 210 323 6.0E-07
sp|Q6PCB6|AB17C_HUMAN Alpha/beta hydrolase domain-containing protein 17C OS=Homo sapiens GN=ABHD17C PE=2 SV=2 210 323 6.0E-07
sp|Q5ZJ01|AB17B_CHICK Alpha/beta hydrolase domain-containing protein 17B OS=Gallus gallus GN=ABHD17B PE=2 SV=1 210 323 8.0E-07
sp|Q6DEY3|AB17B_XENTR Alpha/beta hydrolase domain-containing protein 17B OS=Xenopus tropicalis GN=abhd17b PE=2 SV=1 210 323 8.0E-07
sp|Q6DD70|AB17C_XENLA Alpha/beta hydrolase domain-containing protein 17C OS=Xenopus laevis GN=abhd17c PE=2 SV=1 210 323 9.0E-07
sp|Q99JW1|AB17A_MOUSE Alpha/beta hydrolase domain-containing protein 17A OS=Mus musculus GN=Abhd17a PE=1 SV=1 211 323 1.0E-06
sp|Q5XIJ5|AB17A_RAT Alpha/beta hydrolase domain-containing protein 17A OS=Rattus norvegicus GN=Abhd17a PE=2 SV=1 211 323 1.0E-06
sp|Q6GL10|AB17C_XENTR Alpha/beta hydrolase domain-containing protein 17C OS=Xenopus tropicalis GN=abhd17c PE=2 SV=1 210 323 1.0E-06
sp|P9WLC7|Y2307_MYCTU Uncharacterized protein Rv2307c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2307c PE=1 SV=1 250 310 3.0E-06
sp|P9WLC6|Y2307_MYCTO Uncharacterized protein MT2364 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2364 PE=4 SV=1 250 310 3.0E-06
sp|Q6DCC5|AB17B_XENLA Alpha/beta hydrolase domain-containing protein 17B OS=Xenopus laevis GN=abhd17b PE=2 SV=1 210 323 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 42 0.45

Transmembrane Domains

Domain # Start End Length
1 107 129 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 182.67 93.08 272.26
CcL In ants, during behavior modification 35.03 16.91 53.15
CcD In ants, recently dead 22.83 10.76 34.90

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.099551 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4154
MGKRLVAGDYRVLFKGKAKRKSRKPHDSVDPKTSPSQSLSFWNAQDLPHRIEENALVILYAVSSSSGRRRDWLSS
AGKLSLFRLACFPQLPAVRVMMGMHKLLRTAALLLVAPYAIYVVILFLLAVPVVQRHALYAHKINDLFWTDLNGP
EAWGFASNQVTPFTIATPDGESVYAWHITPLPLYLKNEVRLTAQPSGLSPNFTNTESFRLLREDPNARLILYFHG
TAGHIAQAVRPDSYHALTDTSSYHVVSIDYRGYGHSTGAPTEDGLIQDATALVDWALRVAGISPNRVVLLGHSLG
TAVVSGVAEQYARKGIEFAGIVLVAGFSDLGSLIGGYRIGGLLPLLGPFAAWPALVRRLERFVVDRWHSSNRLAS
IVRHTKTRLRLNLIHARNDRDIPCSEGDKLFRAAANETVGIIDEAEFAAWKEQRTIRKRKDAFVTTWTSDPDIIV
RQELFPYGAHDPIMSYAPVAMAIMRSFDYQGTAYMQTTDGQRRPWLRSHSSLEGP
Coding >Ophio5|4154
ATGGGAAAGAGACTCGTGGCTGGTGACTATAGAGTGCTATTCAAAGGAAAAGCAAAGAGGAAAAGCAGGAAACCA
CATGACTCCGTCGACCCAAAAACCTCCCCGTCGCAAAGTCTCTCCTTCTGGAACGCGCAAGACCTCCCTCATCGG
ATCGAGGAAAATGCGCTGGTTATACTTTACGCCGTCTCTTCCTCATCCGGACGTCGTCGCGACTGGCTCTCGTCG
GCCGGCAAGCTGTCGTTGTTCCGCCTCGCTTGCTTTCCTCAACTGCCAGCGGTCCGAGTCATGATGGGGATGCAC
AAGTTGTTGCGCACCGCCGCGCTGCTCCTCGTCGCGCCCTACGCCATCTACGTCGTTATCCTTTTCCTCCTTGCG
GTCCCCGTCGTCCAGAGACACGCTTTGTACGCCCACAAGATCAATGACCTCTTCTGGACCGATCTCAACGGGCCT
GAGGCCTGGGGCTTCGCCAGCAACCAGGTTACGCCCTTTACCATCGCCACACCCGATGGCGAGAGCGTCTACGCT
TGGCACATTACGCCCCTGCCGCTGTACCTAAAGAACGAGGTCAGACTTACTGCCCAGCCGTCGGGCCTGTCGCCA
AATTTTACCAACACGGAGTCGTTCCGCCTCCTCCGGGAAGATCCTAATGCCAGGCTGATTCTATACTTTCACGGG
ACCGCAGGCCACATCGCGCAGGCCGTTCGCCCCGACTCATACCACGCCTTGACGGACACGTCGTCGTACCACGTC
GTCTCCATCGACTATCGCGGCTACGGTCACTCCACCGGCGCACCGACCGAGGACGGTCTGATACAGGACGCGACG
GCGCTCGTCGACTGGGCGCTCCGGGTGGCCGGCATCTCCCCGAACCGCGTGGTGCTACTGGGGCACAGCCTCGGC
ACGGCCGTCGTTAGCGGCGTCGCTGAGCAATATGCACGGAAAGGGATCGAGTTCGCCGGCATCGTCCTCGTCGCC
GGTTTCAGCGACCTCGGATCGCTCATCGGCGGATACCGCATCGGCGGGCTACTGCCTCTGCTGGGCCCCTTCGCC
GCCTGGCCTGCGCTGGTTCGCAGGCTGGAGCGCTTCGTCGTTGACCGGTGGCACTCGTCGAATCGGCTGGCCAGC
ATCGTGCGCCATACCAAGACTCGGCTGCGTCTCAACCTGATCCACGCCCGCAACGACCGCGACATTCCCTGTAGT
GAAGGCGACAAGCTGTTCCGCGCGGCCGCCAACGAGACGGTCGGCATCATCGACGAAGCCGAGTTCGCGGCGTGG
AAGGAACAGCGCACGATACGTAAGCGCAAAGACGCCTTTGTGACGACATGGACGTCGGATCCGGACATTATCGTT
CGTCAGGAGCTGTTCCCGTATGGAGCGCACGATCCGATCATGAGCTACGCCCCGGTGGCGATGGCCATTATGAGG
TCATTTGATTATCAGGGAACGGCATATATGCAGACGACCGACGGCCAGAGACGGCCATGGCTGCGTAGCCACTCA
AGCTTGGAGGGTCCC
Transcript >Ophio5|4154
ATGGGAAAGAGACTCGTGGCTGGTGACTATAGAGTGCTATTCAAAGGAAAAGCAAAGAGGAAAAGCAGGAAACCA
CATGACTCCGTCGACCCAAAAACCTCCCCGTCGCAAAGTCTCTCCTTCTGGAACGCGCAAGACCTCCCTCATCGG
ATCGAGGAAAATGCGCTGGTTATACTTTACGCCGTCTCTTCCTCATCCGGACGTCGTCGCGACTGGCTCTCGTCG
GCCGGCAAGCTGTCGTTGTTCCGCCTCGCTTGCTTTCCTCAACTGCCAGCGGTCCGAGTCATGATGGGGATGCAC
AAGTTGTTGCGCACCGCCGCGCTGCTCCTCGTCGCGCCCTACGCCATCTACGTCGTTATCCTTTTCCTCCTTGCG
GTCCCCGTCGTCCAGAGACACGCTTTGTACGCCCACAAGATCAATGACCTCTTCTGGACCGATCTCAACGGGCCT
GAGGCCTGGGGCTTCGCCAGCAACCAGGTTACGCCCTTTACCATCGCCACACCCGATGGCGAGAGCGTCTACGCT
TGGCACATTACGCCCCTGCCGCTGTACCTAAAGAACGAGGTCAGACTTACTGCCCAGCCGTCGGGCCTGTCGCCA
AATTTTACCAACACGGAGTCGTTCCGCCTCCTCCGGGAAGATCCTAATGCCAGGCTGATTCTATACTTTCACGGG
ACCGCAGGCCACATCGCGCAGGCCGTTCGCCCCGACTCATACCACGCCTTGACGGACACGTCGTCGTACCACGTC
GTCTCCATCGACTATCGCGGCTACGGTCACTCCACCGGCGCACCGACCGAGGACGGTCTGATACAGGACGCGACG
GCGCTCGTCGACTGGGCGCTCCGGGTGGCCGGCATCTCCCCGAACCGCGTGGTGCTACTGGGGCACAGCCTCGGC
ACGGCCGTCGTTAGCGGCGTCGCTGAGCAATATGCACGGAAAGGGATCGAGTTCGCCGGCATCGTCCTCGTCGCC
GGTTTCAGCGACCTCGGATCGCTCATCGGCGGATACCGCATCGGCGGGCTACTGCCTCTGCTGGGCCCCTTCGCC
GCCTGGCCTGCGCTGGTTCGCAGGCTGGAGCGCTTCGTCGTTGACCGGTGGCACTCGTCGAATCGGCTGGCCAGC
ATCGTGCGCCATACCAAGACTCGGCTGCGTCTCAACCTGATCCACGCCCGCAACGACCGCGACATTCCCTGTAGT
GAAGGCGACAAGCTGTTCCGCGCGGCCGCCAACGAGACGGTCGGCATCATCGACGAAGCCGAGTTCGCGGCGTGG
AAGGAACAGCGCACGATACGTAAGCGCAAAGACGCCTTTGTGACGACATGGACGTCGGATCCGGACATTATCGTT
CGTCAGGAGCTGTTCCCGTATGGAGCGCACGATCCGATCATGAGCTACGCCCCGGTGGCGATGGCCATTATGAGG
TCATTTGATTATCAGGGAACGGCATATATGCAGACGACCGACGGCCAGAGACGGCCATGGCTGCGTAGCCACTCA
AGCTTGGAGGGTCCCTGA
Gene >Ophio5|4154
ATGGGAAAGAGACTCGTGGCTGGTGACTATAGAGTGCTATTCAAAGGCATGAATGAACGTCCTGATTCCCGACGC
CAAGGCCAGTGTCTGACGATGACGACAGGAAAAGCAAAGAGGAAAAGCAGGGTAAATCAATCGCATGAATTACGA
AAGAAAAAAAAAAAGGAAAAATTAAATAAATAGAAACCACATGACTCCGTCGACCCAAAAACCTCCCCGTCGCAA
AGTCTCTCCTTCTGGAACGCGCAAGACCTCCCTCATCGGATCGAGGAAAATGCGCTGGTTATACTTTACGCCGTC
TCTTCCTCATCCGGACGTCGTCGCGACTGGCTCTCGTCGGCCGGCAAGCTGTCGTTGTTCCGCCTCGCTTGCTTT
CCTCAACTGCCAGCGGTCCGAGTCATGATGGGGATGCACAAGTTGTTGCGCACCGCCGCGCTGCTCCTCGTCGCG
CCCTACGCCATCTACGTCGTTATCCTTTTCCTCCTTGCGGTCCCCGTCGTCCAGAGACAGTCAGTGGCCTGTTCC
GCCGTATCCGCCGCTACTTGGTACCCAGCTGACGCCGAGATACTGCAGCGCTTTGTACGCCCACAAGATCAATGA
CCTCTTCTGGACCGATCTCAACGGGCCTGAGGCCTGGGGCTTCGCCAGTATGTCGCCGGGAAAGCTAGGTGGACC
TTGTCCTGACAGTGATGCTCGCAGGCAACCAGGTTACGCCCTTTACCATCGCCACACCCGATGGCGAGAGCGTCT
ACGCTTGGCACATTACGCCCCTGCCGCTGTACCTAAAGAACGAGGTCAGACTTACTGCCCAGCCGTCGGGCCTGT
CGCCAAATTTTACCAACACGGAGTCGTTCCGCCTCCTCCGGGAAGATCCTAATGCCAGGCTGATTCTATACTGTG
AGCCGGATCGCTGTCTGTCGGATCGTTGGGATGTCGAAGCTAACGCCTCATATCAGTTCACGGGGTACGTCGGAC
GAGCGCCGAAACAAGTAGGTGGAAGCTCACATCGAATACAGACCGCAGGCCACATCGCGCAGGCCGTTCGCCCCG
ACTCATACCACGCCTTGACGGACACGTCGTCGTACCACGTCGTCTCCATCGACTATCGCGGCTACGGTCACTCCA
CCGGCGCACCGACCGAGGACGGTCTGATACAGGACGCGACGGCGCTCGTCGACTGGGCGCTCCGGGTGGCCGGCA
TCTCCCCGAACCGCGTGGTGCTACTGGGGCACAGCCTCGGCACGGCCGTCGTTAGCGGCGTCGCTGAGCAATATG
CACGGAAAGGGATCGAGTTCGCCGGCATCGTCCTCGTCGCCGGTTTCAGCGACCTCGGATCGCTCATCGGCGGAT
ACCGCATCGGCGGGCTACTGCCTCTGCTGGGCCCCTTCGCCGCCTGGCCTGCGCTGGTTCGCAGGCTGGAGCGCT
TCGTCGTTGACCGGTGGCACTCGTCGAATCGGCTGGCCAGCATCGTGCGCCATACCAAGACTCGGCTGCGTCTCA
ACCTGATCCACGCCCGCAACGACCGCGACATTCCCTGTAGTGAAGGCGACAAGCTGTTCCGCGCGGCCGCCAACG
AGACGGTCGGCATCATCGACGAAGCCGAGTTCGCGGCGTGGAAGGAACAGCGCACGATACGTAAGCGCAAAGACG
CCTTTGTGACGACATGGACGTCGGATCCGGACATTATCGTTCGTCAGGAGCTGTTCCCGTATGGAGGTGAGTGAG
GCCTAGCTTGGAGGCGGCGCGGATACGTGCTGACTGGCGATGGGCAGCGCACGATCCGATCATGAGCTACGCCCC
GGTGGCGATGGCCATTATGAGGTCATTTGATTATCAGGGAACGGCATATATGCAGACGACCGACGGCCAGAGACG
GCCATGGCTGCGTAGCCACTCAAGCTTGGAGGGTCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail