Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4144
Gene name
Locationscaffold_326:1560..4190
Strand-
Gene length (bp)2630
Transcript length (bp)2493
Coding sequence length (bp)2490
Protein length (aa) 830

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07780 Spb1_C Spb1 C-terminal domain 4.6E-85 629 825
PF01728 FtsJ FtsJ-like methyltransferase 4.0E-54 24 200
PF11861 DUF3381 Domain of unknown function (DUF3381) 8.9E-52 234 390

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q52C47|SPB1_MAGO7 AdoMet-dependent rRNA methyltransferase SPB1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SPB1 PE=3 SV=2 1 830 0.0E+00
sp|Q9P6V8|SPB1_NEUCR AdoMet-dependent rRNA methyltransferase spb1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spb1 PE=3 SV=2 1 828 0.0E+00
sp|Q5BH88|SPB1_EMENI AdoMet-dependent rRNA methyltransferase spb1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spb1 PE=3 SV=1 1 830 0.0E+00
sp|Q4WVH3|SPB1_ASPFU AdoMet-dependent rRNA methyltransferase spb1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spb1 PE=3 SV=1 1 829 0.0E+00
sp|Q6CV12|SPB1_KLULA AdoMet-dependent rRNA methyltransferase SPB1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SPB1 PE=3 SV=1 4 827 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q52C47|SPB1_MAGO7 AdoMet-dependent rRNA methyltransferase SPB1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SPB1 PE=3 SV=2 1 830 0.0E+00
sp|Q9P6V8|SPB1_NEUCR AdoMet-dependent rRNA methyltransferase spb1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=spb1 PE=3 SV=2 1 828 0.0E+00
sp|Q5BH88|SPB1_EMENI AdoMet-dependent rRNA methyltransferase spb1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=spb1 PE=3 SV=1 1 830 0.0E+00
sp|Q4WVH3|SPB1_ASPFU AdoMet-dependent rRNA methyltransferase spb1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=spb1 PE=3 SV=1 1 829 0.0E+00
sp|Q6CV12|SPB1_KLULA AdoMet-dependent rRNA methyltransferase SPB1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SPB1 PE=3 SV=1 4 827 0.0E+00
sp|O42832|SPB1_SCHPO AdoMet-dependent rRNA methyltransferase spb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spb1 PE=1 SV=2 4 830 0.0E+00
sp|P25582|SPB1_YEAST 27S pre-rRNA (guanosine(2922)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPB1 PE=1 SV=2 4 827 0.0E+00
sp|Q6FX63|SPB1_CANGA AdoMet-dependent rRNA methyltransferase SPB1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SPB1 PE=3 SV=1 4 825 0.0E+00
sp|Q59KF3|SPB1_CANAL AdoMet-dependent rRNA methyltransferase SPB1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SPB1 PE=3 SV=1 4 830 0.0E+00
sp|Q6BNQ8|SPB1_DEBHA AdoMet-dependent rRNA methyltransferase SPB1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SPB1 PE=3 SV=2 4 830 0.0E+00
sp|Q6C9Q1|SPB1_YARLI AdoMet-dependent rRNA methyltransferase SPB1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SPB1 PE=3 SV=1 3 827 0.0E+00
sp|Q751U1|SPB1_ASHGO AdoMet-dependent rRNA methyltransferase SPB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SPB1 PE=3 SV=2 4 566 0.0E+00
sp|P0CS78|SPB1_CRYNJ AdoMet-dependent rRNA methyltransferase SPB1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SPB1 PE=3 SV=1 5 506 1.0E-147
sp|P0CS79|SPB1_CRYNB AdoMet-dependent rRNA methyltransferase SPB1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SPB1 PE=3 SV=1 5 506 1.0E-147
sp|Q5ZKM1|SPB1_CHICK pre-rRNA processing protein FTSJ3 OS=Gallus gallus GN=FTSJ3 PE=2 SV=2 1 436 2.0E-111
sp|Q5RJT2|SPB1_RAT pre-rRNA processing protein FTSJ3 OS=Rattus norvegicus GN=Ftsj3 PE=1 SV=1 1 328 3.0E-111
sp|Q9DBE9|SPB1_MOUSE pre-rRNA processing protein FTSJ3 OS=Mus musculus GN=Ftsj3 PE=1 SV=1 1 328 1.0E-110
sp|Q8IY81|SPB1_HUMAN pre-rRNA processing protein FTSJ3 OS=Homo sapiens GN=FTSJ3 PE=1 SV=2 1 328 8.0E-110
sp|Q5RAS1|SPB1_PONAB pre-rRNA processing protein FTSJ3 OS=Pongo abelii GN=FTSJ3 PE=2 SV=1 1 328 9.0E-110
sp|Q54NX0|SPB1_DICDI Putative rRNA methyltransferase OS=Dictyostelium discoideum GN=fsjC PE=3 SV=1 4 323 7.0E-107
sp|Q4P6G5|SPB1_USTMA AdoMet-dependent rRNA methyltransferase SPB1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SPB1 PE=3 SV=1 646 827 1.0E-48
sp|O36015|TRM7_SCHPO Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.03c PE=3 SV=1 6 245 5.0E-46
sp|P38238|TRM7_YEAST tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRM7 PE=1 SV=1 6 210 4.0E-44
sp|Q9UET6|TRM7_HUMAN Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Homo sapiens GN=FTSJ1 PE=1 SV=2 9 213 4.0E-41
sp|P0CS78|SPB1_CRYNJ AdoMet-dependent rRNA methyltransferase SPB1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SPB1 PE=3 SV=1 646 824 1.0E-39
sp|P0CS79|SPB1_CRYNB AdoMet-dependent rRNA methyltransferase SPB1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SPB1 PE=3 SV=1 646 824 1.0E-39
sp|Q22031|TRM7_CAEEL Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Caenorhabditis elegans GN=R74.7 PE=3 SV=3 6 210 3.0E-39
sp|Q54VA8|TRM7_DICDI Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase OS=Dictyostelium discoideum GN=fsjA PE=3 SV=1 6 213 4.0E-38
sp|Q9VEP1|TRM71_DROME Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase 1 OS=Drosophila melanogaster GN=CG5220 PE=2 SV=1 6 213 8.0E-35
sp|A0B8A1|RLME_METTP Ribosomal RNA large subunit methyltransferase E OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rlmE PE=3 SV=1 13 205 2.0E-34
sp|Q58771|RLME_METJA Ribosomal RNA large subunit methyltransferase E OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rlmE PE=3 SV=1 13 200 3.0E-34
sp|Q9VDD9|TRM72_DROME Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase 2 OS=Drosophila melanogaster GN=CG7009 PE=3 SV=1 6 208 9.0E-34
sp|A6UUK5|RLME_META3 Ribosomal RNA large subunit methyltransferase E OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rlmE PE=3 SV=1 13 200 1.0E-33
sp|Q8TR92|RLME_METAC Ribosomal RNA large subunit methyltransferase E OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rlmE PE=3 SV=1 9 205 1.0E-33
sp|B9LSX2|RLME_HALLT Ribosomal RNA large subunit methyltransferase E OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rlmE PE=3 SV=1 13 201 3.0E-33
sp|Q8PUP4|RLME_METMA Ribosomal RNA large subunit methyltransferase E OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rlmE PE=3 SV=1 9 205 6.0E-33
sp|Q466Q1|RLME_METBF Ribosomal RNA large subunit methyltransferase E OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rlmE PE=3 SV=1 9 205 8.0E-33
sp|Q6LZL8|RLME_METMP Ribosomal RNA large subunit methyltransferase E OS=Methanococcus maripaludis (strain S2 / LL) GN=rlmE PE=3 SV=1 13 228 2.0E-32
sp|A4FYM2|RLME_METM5 Ribosomal RNA large subunit methyltransferase E OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rlmE PE=3 SV=1 13 238 5.0E-32
sp|A6VJR0|RLME_METM7 Ribosomal RNA large subunit methyltransferase E OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rlmE PE=3 SV=1 13 238 6.0E-32
sp|A9A6B9|RLME_METM6 Ribosomal RNA large subunit methyltransferase E OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rlmE PE=3 SV=1 13 228 8.0E-32
sp|Q3IT24|RLME_NATPD Ribosomal RNA large subunit methyltransferase E OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rlmE PE=3 SV=1 10 205 9.0E-32
sp|Q0W1F9|RLME_METAR Ribosomal RNA large subunit methyltransferase E OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rlmE PE=3 SV=1 13 200 1.0E-31
sp|Q0BT08|RLME_GRABC Ribosomal RNA large subunit methyltransferase E OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rlmE PE=3 SV=1 13 206 2.0E-31
sp|A6USA0|RLME_METVS Ribosomal RNA large subunit methyltransferase E OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rlmE PE=3 SV=1 13 200 4.0E-31
sp|Q2NHD6|RLME_METST Ribosomal RNA large subunit methyltransferase E OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rlmE PE=3 SV=1 9 205 3.0E-30
sp|Q2GB53|RLME_NOVAD Ribosomal RNA large subunit methyltransferase E OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rlmE PE=3 SV=1 13 201 3.0E-30
sp|A5VFI9|RLME_SPHWW Ribosomal RNA large subunit methyltransferase E OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rlmE PE=3 SV=1 13 202 8.0E-30
sp|Q9HN40|RLME_HALSA Ribosomal RNA large subunit methyltransferase E OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rlmE PE=3 SV=1 10 198 2.0E-29
sp|B0R7G3|RLME_HALS3 Ribosomal RNA large subunit methyltransferase E OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rlmE PE=3 SV=1 10 198 2.0E-29
sp|Q5LSB0|RLME_RUEPO Ribosomal RNA large subunit methyltransferase E OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rlmE PE=3 SV=1 13 202 2.0E-29
sp|Q12WR3|RLME_METBU Ribosomal RNA large subunit methyltransferase E OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rlmE PE=3 SV=1 9 210 2.0E-29
sp|Q5FNQ1|RLME_GLUOX Ribosomal RNA large subunit methyltransferase E OS=Gluconobacter oxydans (strain 621H) GN=rlmE PE=3 SV=1 13 206 6.0E-29
sp|A5G029|RLME_ACICJ Ribosomal RNA large subunit methyltransferase E OS=Acidiphilium cryptum (strain JF-5) GN=rlmE PE=3 SV=1 13 201 7.0E-29
sp|Q2N843|RLME_ERYLH Ribosomal RNA large subunit methyltransferase E OS=Erythrobacter litoralis (strain HTCC2594) GN=rlmE PE=3 SV=1 13 202 9.0E-29
sp|Q1GPG3|RLME_SPHAL Ribosomal RNA large subunit methyltransferase E OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rlmE PE=3 SV=1 13 201 1.0E-28
sp|Q5F9L0|RLME_NEIG1 Ribosomal RNA large subunit methyltransferase E OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rlmE PE=3 SV=1 1 196 2.0E-28
sp|Q7DDL2|RLME_NEIMB Ribosomal RNA large subunit methyltransferase E OS=Neisseria meningitidis serogroup B (strain MC58) GN=rlmE PE=3 SV=1 1 196 2.0E-28
sp|Q9JQX5|RLME_NEIMA Ribosomal RNA large subunit methyltransferase E OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rlmE PE=3 SV=1 1 196 2.0E-28
sp|A9M3N1|RLME_NEIM0 Ribosomal RNA large subunit methyltransferase E OS=Neisseria meningitidis serogroup C (strain 053442) GN=rlmE PE=3 SV=1 1 196 2.0E-28
sp|B4RK82|RLME_NEIG2 Ribosomal RNA large subunit methyltransferase E OS=Neisseria gonorrhoeae (strain NCCP11945) GN=rlmE PE=3 SV=1 1 196 2.0E-28
sp|A1TXM4|RLME_MARHV Ribosomal RNA large subunit methyltransferase E OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rlmE PE=3 SV=1 13 202 3.0E-28
sp|A0RV28|RLME_CENSY Ribosomal RNA large subunit methyltransferase E OS=Cenarchaeum symbiosum (strain A) GN=rlmE PE=3 SV=1 13 202 3.0E-28
sp|A1KT57|RLME_NEIMF Ribosomal RNA large subunit methyltransferase E OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rlmE PE=3 SV=1 1 196 3.0E-28
sp|A3PJK8|RLME_RHOS1 Ribosomal RNA large subunit methyltransferase E OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rlmE PE=3 SV=1 13 202 3.0E-28
sp|Q3J2Q5|RLME_RHOS4 Ribosomal RNA large subunit methyltransferase E OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rlmE PE=3 SV=1 13 202 4.0E-28
sp|Q2KVR5|RLME_BORA1 Ribosomal RNA large subunit methyltransferase E OS=Bordetella avium (strain 197N) GN=rlmE PE=3 SV=1 13 203 5.0E-28
sp|Q5NQH8|RLME_ZYMMO Ribosomal RNA large subunit methyltransferase E OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rlmE PE=3 SV=1 13 201 5.0E-28
sp|Q7NRI3|RLME_CHRVO Ribosomal RNA large subunit methyltransferase E OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=rlmE PE=3 SV=1 13 199 6.0E-28
sp|Q0A769|RLME_ALKEH Ribosomal RNA large subunit methyltransferase E OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rlmE PE=3 SV=1 13 200 7.0E-28
sp|Q164M8|RLME_ROSDO Ribosomal RNA large subunit methyltransferase E OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rlmE PE=3 SV=1 13 202 9.0E-28
sp|A1K598|RLME_AZOSB Ribosomal RNA large subunit methyltransferase E OS=Azoarcus sp. (strain BH72) GN=rlmE PE=3 SV=1 13 196 1.0E-27
sp|O28228|RLME_ARCFU Ribosomal RNA large subunit methyltransferase E OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rlmE PE=3 SV=1 9 201 1.0E-27
sp|A5UKI5|RLME_METS3 Ribosomal RNA large subunit methyltransferase E OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rlmE PE=3 SV=1 3 200 2.0E-27
sp|Q18E61|RLME_HALWD Ribosomal RNA large subunit methyltransferase E OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rlmE PE=3 SV=1 13 198 4.0E-27
sp|A1B962|RLME_PARDP Ribosomal RNA large subunit methyltransferase E OS=Paracoccus denitrificans (strain Pd 1222) GN=rlmE PE=3 SV=1 13 202 4.0E-27
sp|A9IMA1|RLME_BART1 Ribosomal RNA large subunit methyltransferase E OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rlmE PE=3 SV=1 13 206 4.0E-27
sp|Q5UYP9|RLME_HALMA Ribosomal RNA large subunit methyltransferase E OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rlmE PE=3 SV=1 13 198 5.0E-27
sp|B7VJI4|RLME_VIBTL Ribosomal RNA large subunit methyltransferase E OS=Vibrio tasmaniensis (strain LGP32) GN=rlmE PE=3 SV=1 13 202 7.0E-27
sp|Q5PAN0|RLME_ANAMM Ribosomal RNA large subunit methyltransferase E OS=Anaplasma marginale (strain St. Maries) GN=rlmE PE=3 SV=1 18 203 1.0E-26
sp|B9KIP4|RLME_ANAMF Ribosomal RNA large subunit methyltransferase E OS=Anaplasma marginale (strain Florida) GN=rlmE PE=3 SV=1 18 203 1.0E-26
sp|A1W8H0|RLME_ACISJ Ribosomal RNA large subunit methyltransferase E OS=Acidovorax sp. (strain JS42) GN=rlmE PE=3 SV=2 13 201 1.0E-26
sp|O27801|RLME_METTH Ribosomal RNA large subunit methyltransferase E OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rlmE PE=3 SV=1 13 202 1.0E-26
sp|Q21H48|RLME_SACD2 Ribosomal RNA large subunit methyltransferase E OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rlmE PE=3 SV=1 13 202 1.0E-26
sp|Q2SMM1|RLME_HAHCH Ribosomal RNA large subunit methyltransferase E OS=Hahella chejuensis (strain KCTC 2396) GN=rlmE PE=3 SV=1 13 202 2.0E-26
sp|Q87LZ4|RLME_VIBPA Ribosomal RNA large subunit methyltransferase E OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rlmE PE=3 SV=1 13 202 2.0E-26
sp|A5VUZ8|RLME_BRUO2 Ribosomal RNA large subunit methyltransferase E OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rlmE PE=3 SV=2 13 202 2.0E-26
sp|Q8FVY1|RLME_BRUSU Ribosomal RNA large subunit methyltransferase E OS=Brucella suis biovar 1 (strain 1330) GN=rlmE PE=3 SV=2 13 202 2.0E-26
sp|A9WYY2|RLME_BRUSI Ribosomal RNA large subunit methyltransferase E OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rlmE PE=3 SV=1 13 202 2.0E-26
sp|Q8YCD5|RLME_BRUME Ribosomal RNA large subunit methyltransferase E OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rlmE PE=3 SV=1 13 202 2.0E-26
sp|C0RLJ5|RLME_BRUMB Ribosomal RNA large subunit methyltransferase E OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rlmE PE=3 SV=1 13 202 2.0E-26
sp|A9MBW8|RLME_BRUC2 Ribosomal RNA large subunit methyltransferase E OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rlmE PE=3 SV=1 13 202 2.0E-26
sp|Q578H4|RLME_BRUAB Ribosomal RNA large subunit methyltransferase E OS=Brucella abortus biovar 1 (strain 9-941) GN=rlmE PE=3 SV=2 13 202 2.0E-26
sp|Q2YKU4|RLME_BRUA2 Ribosomal RNA large subunit methyltransferase E OS=Brucella abortus (strain 2308) GN=rlmE PE=3 SV=2 13 202 2.0E-26
sp|B2SAY0|RLME_BRUA1 Ribosomal RNA large subunit methyltransferase E OS=Brucella abortus (strain S19) GN=rlmE PE=3 SV=1 13 202 2.0E-26
sp|Q6G0S9|RLME_BARQU Ribosomal RNA large subunit methyltransferase E OS=Bartonella quintana (strain Toulouse) GN=rlmE PE=3 SV=1 13 202 2.0E-26
sp|Q607B2|RLME_METCA Ribosomal RNA large subunit methyltransferase E OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rlmE PE=3 SV=1 13 205 2.0E-26
sp|A2SSW7|RLME_METLZ Ribosomal RNA large subunit methyltransferase E OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rlmE PE=3 SV=1 13 200 2.0E-26
sp|Q3SJR5|RLME_THIDA Ribosomal RNA large subunit methyltransferase E OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rlmE PE=3 SV=1 13 198 2.0E-26
sp|C1DFL6|RLME_AZOVD Ribosomal RNA large subunit methyltransferase E OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rlmE PE=3 SV=1 13 202 3.0E-26
sp|A6X5L4|RLME_OCHA4 Ribosomal RNA large subunit methyltransferase E OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rlmE PE=3 SV=1 13 202 3.0E-26
sp|Q2W0P2|RLME_MAGSA Ribosomal RNA large subunit methyltransferase E OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rlmE PE=3 SV=1 13 202 4.0E-26
sp|A7MZH4|RLME_VIBCB Ribosomal RNA large subunit methyltransferase E OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rlmE PE=3 SV=1 13 202 4.0E-26
sp|B0T8J6|RLME_CAUSK Ribosomal RNA large subunit methyltransferase E OS=Caulobacter sp. (strain K31) GN=rlmE PE=3 SV=2 13 202 4.0E-26
sp|Q5RAS1|SPB1_PONAB pre-rRNA processing protein FTSJ3 OS=Pongo abelii GN=FTSJ3 PE=2 SV=1 649 820 9.0E-26
sp|Q086I0|RLME_SHEFN Ribosomal RNA large subunit methyltransferase E OS=Shewanella frigidimarina (strain NCIMB 400) GN=rlmE PE=3 SV=1 13 201 9.0E-26
sp|A7HSA5|RLME_PARL1 Ribosomal RNA large subunit methyltransferase E OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rlmE PE=3 SV=1 13 202 1.0E-25
sp|Q4ZNQ4|RLME_PSEU2 Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rlmE PE=3 SV=1 13 202 1.0E-25
sp|C3LSP1|RLME_VIBCM Ribosomal RNA large subunit methyltransferase E OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rlmE PE=3 SV=1 13 202 1.0E-25
sp|Q9KU87|RLME_VIBCH Ribosomal RNA large subunit methyltransferase E OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rlmE PE=3 SV=1 13 202 1.0E-25
sp|A5F937|RLME_VIBC3 Ribosomal RNA large subunit methyltransferase E OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rlmE PE=3 SV=1 13 202 1.0E-25
sp|P95454|RLME_PSEAE Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rlmE PE=3 SV=2 13 202 2.0E-25
sp|Q02FS0|RLME_PSEAB Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rlmE PE=3 SV=1 13 202 2.0E-25
sp|B7V1G4|RLME_PSEA8 Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas aeruginosa (strain LESB58) GN=rlmE PE=3 SV=1 13 202 2.0E-25
sp|Q87WP7|RLME_PSESM Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rlmE PE=3 SV=1 13 202 2.0E-25
sp|Q4FMX1|RLME_PELUB Ribosomal RNA large subunit methyltransferase E OS=Pelagibacter ubique (strain HTCC1062) GN=rlmE PE=3 SV=1 9 198 2.0E-25
sp|A6VCK9|RLME_PSEA7 Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas aeruginosa (strain PA7) GN=rlmE PE=3 SV=1 13 202 2.0E-25
sp|Q92RT9|RLME_RHIME Ribosomal RNA large subunit methyltransferase E OS=Rhizobium meliloti (strain 1021) GN=rlmE PE=3 SV=1 13 207 2.0E-25
sp|Q4KIG3|RLME_PSEF5 Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rlmE PE=3 SV=1 13 202 2.0E-25
sp|Q48E69|RLME_PSE14 Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rlmE PE=3 SV=1 13 202 3.0E-25
sp|Q7W8R6|RLME_BORPA Ribosomal RNA large subunit methyltransferase E OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rlmE PE=3 SV=1 13 201 3.0E-25
sp|Q7WMD3|RLME_BORBR Ribosomal RNA large subunit methyltransferase E OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rlmE PE=3 SV=1 13 201 3.0E-25
sp|A1WEE7|RLME_VEREI Ribosomal RNA large subunit methyltransferase E OS=Verminephrobacter eiseniae (strain EF01-2) GN=rlmE PE=3 SV=1 13 209 3.0E-25
sp|B6J802|RLME_COXB1 Ribosomal RNA large subunit methyltransferase E OS=Coxiella burnetii (strain CbuK_Q154) GN=rlmE PE=3 SV=1 13 205 3.0E-25
sp|A1ST38|RLME_PSYIN Ribosomal RNA large subunit methyltransferase E OS=Psychromonas ingrahamii (strain 37) GN=rlmE PE=3 SV=1 13 202 3.0E-25
sp|A1URN3|RLME_BARBK Ribosomal RNA large subunit methyltransferase E OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rlmE PE=3 SV=1 13 202 3.0E-25
sp|A1S454|RLME_SHEAM Ribosomal RNA large subunit methyltransferase E OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rlmE PE=3 SV=1 13 201 4.0E-25
sp|B0TZQ8|RLME_FRAP2 Ribosomal RNA large subunit methyltransferase E OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rlmE PE=3 SV=1 15 202 4.0E-25
sp|A1TQF0|RLME_ACIAC Ribosomal RNA large subunit methyltransferase E OS=Acidovorax citrulli (strain AAC00-1) GN=rlmE PE=3 SV=1 13 201 5.0E-25
sp|C3K267|RLME_PSEFS Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas fluorescens (strain SBW25) GN=rlmE PE=3 SV=1 13 202 5.0E-25
sp|Q6MN40|RLME_BDEBA Ribosomal RNA large subunit methyltransferase E OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rlmE PE=3 SV=1 13 196 5.0E-25
sp|Q7VZ56|RLME_BORPE Ribosomal RNA large subunit methyltransferase E OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rlmE PE=3 SV=1 13 201 6.0E-25
sp|Q73IS9|RLME_WOLPM Ribosomal RNA large subunit methyltransferase E OS=Wolbachia pipientis wMel GN=rlmE PE=3 SV=1 13 200 7.0E-25
sp|Q0AQH3|RLME_MARMM Ribosomal RNA large subunit methyltransferase E OS=Maricaulis maris (strain MCS10) GN=rlmE PE=3 SV=1 13 202 7.0E-25
sp|C4L8Y1|RLME_TOLAT Ribosomal RNA large subunit methyltransferase E OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=rlmE PE=3 SV=1 13 201 8.0E-25
sp|A9HYV0|RLME_BORPD Ribosomal RNA large subunit methyltransferase E OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rlmE PE=3 SV=1 13 202 8.0E-25
sp|Q83BY4|RLME_COXBU Ribosomal RNA large subunit methyltransferase E OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rlmE PE=3 SV=1 13 205 8.0E-25
sp|A9KGE6|RLME_COXBN Ribosomal RNA large subunit methyltransferase E OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rlmE PE=3 SV=1 13 205 8.0E-25
sp|B6IZD5|RLME_COXB2 Ribosomal RNA large subunit methyltransferase E OS=Coxiella burnetii (strain CbuG_Q212) GN=rlmE PE=3 SV=1 13 205 8.0E-25
sp|A9N8M5|RLME_COXBR Ribosomal RNA large subunit methyltransferase E OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rlmE PE=3 SV=1 13 205 1.0E-24
sp|Q2FNX6|RLME_METHJ Ribosomal RNA large subunit methyltransferase E OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rlmE PE=3 SV=1 13 200 1.0E-24
sp|A4XYE8|RLME_PSEMY Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas mendocina (strain ymp) GN=rlmE PE=3 SV=1 13 202 1.0E-24
sp|Q3J823|RLME_NITOC Ribosomal RNA large subunit methyltransferase E OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=rlmE PE=3 SV=1 1 198 1.0E-24
sp|A4SJQ7|RLME_AERS4 Ribosomal RNA large subunit methyltransferase E OS=Aeromonas salmonicida (strain A449) GN=rlmE PE=3 SV=1 13 201 1.0E-24
sp|Q9A7V4|RLME_CAUCR Ribosomal RNA large subunit methyltransferase E OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rlmE PE=3 SV=1 13 202 2.0E-24
sp|Q6LUJ9|RLME_PHOPR Ribosomal RNA large subunit methyltransferase E OS=Photobacterium profundum GN=rlmE PE=3 SV=1 13 201 2.0E-24
sp|Q6G4Z3|RLME_BARHE Ribosomal RNA large subunit methyltransferase E OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rlmE PE=3 SV=1 13 202 2.0E-24
sp|Q12QI9|RLME_SHEDO Ribosomal RNA large subunit methyltransferase E OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rlmE PE=3 SV=1 13 201 2.0E-24
sp|A1WXX3|RLME_HALHL Ribosomal RNA large subunit methyltransferase E OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=rlmE PE=3 SV=1 4 199 2.0E-24
sp|Q7MI01|RLME_VIBVY Ribosomal RNA large subunit methyltransferase E OS=Vibrio vulnificus (strain YJ016) GN=rlmE PE=3 SV=1 13 202 2.0E-24
sp|Q8DBW7|RLME_VIBVU Ribosomal RNA large subunit methyltransferase E OS=Vibrio vulnificus (strain CMCP6) GN=rlmE PE=3 SV=1 13 202 2.0E-24
sp|A1VQI6|RLME_POLNA Ribosomal RNA large subunit methyltransferase E OS=Polaromonas naphthalenivorans (strain CJ2) GN=rlmE PE=3 SV=1 13 201 2.0E-24
sp|O62251|MRM2_CAEEL rRNA methyltransferase 2, mitochondrial OS=Caenorhabditis elegans GN=F45G2.9 PE=3 SV=1 19 201 3.0E-24
sp|B4F2B2|RLME_PROMH Ribosomal RNA large subunit methyltransferase E OS=Proteus mirabilis (strain HI4320) GN=rlmE PE=3 SV=1 13 199 4.0E-24
sp|Q0C187|RLME_HYPNA Ribosomal RNA large subunit methyltransferase E OS=Hyphomonas neptunium (strain ATCC 15444) GN=rlmE PE=3 SV=1 13 201 4.0E-24
sp|Q138J5|RLME_RHOPS Ribosomal RNA large subunit methyltransferase E OS=Rhodopseudomonas palustris (strain BisB5) GN=rlmE PE=3 SV=1 13 212 4.0E-24
sp|Q39HN2|RLME_BURL3 Ribosomal RNA large subunit methyltransferase E OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rlmE PE=3 SV=1 13 203 5.0E-24
sp|A9A3M9|RLME_NITMS Ribosomal RNA large subunit methyltransferase E OS=Nitrosopumilus maritimus (strain SCM1) GN=rlmE PE=3 SV=1 10 200 5.0E-24
sp|Q21WW8|RLME_RHOFT Ribosomal RNA large subunit methyltransferase E OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rlmE PE=3 SV=1 13 201 5.0E-24
sp|Q1GHF1|RLME_RUEST Ribosomal RNA large subunit methyltransferase E OS=Ruegeria sp. (strain TM1040) GN=rlmE PE=3 SV=1 13 202 6.0E-24
sp|B5XSW2|RLME_KLEP3 Ribosomal RNA large subunit methyltransferase E OS=Klebsiella pneumoniae (strain 342) GN=rlmE PE=3 SV=1 13 201 7.0E-24
sp|Q4UKG2|RLME_RICFE Ribosomal RNA large subunit methyltransferase E OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rlmE PE=3 SV=1 13 197 7.0E-24
sp|Q47HI2|RLME_DECAR Ribosomal RNA large subunit methyltransferase E OS=Dechloromonas aromatica (strain RCB) GN=rlmE PE=3 SV=1 13 201 8.0E-24
sp|A3QGV3|RLME_SHELP Ribosomal RNA large subunit methyltransferase E OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rlmE PE=3 SV=1 13 201 8.0E-24
sp|B3PLQ4|RLME_CELJU Ribosomal RNA large subunit methyltransferase E OS=Cellvibrio japonicus (strain Ueda107) GN=rlmE PE=3 SV=1 13 200 9.0E-24
sp|A8FYS8|RLME_SHESH Ribosomal RNA large subunit methyltransferase E OS=Shewanella sediminis (strain HAW-EB3) GN=rlmE PE=3 SV=1 13 201 9.0E-24
sp|Q129M4|RLME_POLSJ Ribosomal RNA large subunit methyltransferase E OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rlmE PE=3 SV=1 13 201 1.0E-23
sp|A6TEJ8|RLME_KLEP7 Ribosomal RNA large subunit methyltransferase E OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rlmE PE=3 SV=1 13 201 1.0E-23
sp|B4E5F3|RLME_BURCJ Ribosomal RNA large subunit methyltransferase E OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rlmE PE=3 SV=1 13 203 1.0E-23
sp|A0K6C1|RLME_BURCH Ribosomal RNA large subunit methyltransferase E OS=Burkholderia cenocepacia (strain HI2424) GN=rlmE PE=3 SV=1 13 203 1.0E-23
sp|B1JZE9|RLME_BURCC Ribosomal RNA large subunit methyltransferase E OS=Burkholderia cenocepacia (strain MC0-3) GN=rlmE PE=3 SV=1 13 203 1.0E-23
sp|Q1BXD0|RLME_BURCA Ribosomal RNA large subunit methyltransferase E OS=Burkholderia cenocepacia (strain AU 1054) GN=rlmE PE=3 SV=1 13 203 1.0E-23
sp|B1KRR8|RLME_SHEWM Ribosomal RNA large subunit methyltransferase E OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rlmE PE=3 SV=1 13 201 1.0E-23
sp|B2JFN9|RLME_BURP8 Ribosomal RNA large subunit methyltransferase E OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rlmE PE=3 SV=1 13 203 1.0E-23
sp|Q2GDL7|RLME_NEOSM Ribosomal RNA large subunit methyltransferase E OS=Neorickettsia sennetsu (strain Miyayama) GN=rlmE PE=3 SV=1 13 199 1.0E-23
sp|A1RGW7|RLME_SHESW Ribosomal RNA large subunit methyltransferase E OS=Shewanella sp. (strain W3-18-1) GN=rlmE PE=3 SV=1 13 201 1.0E-23
sp|A4Y9C8|RLME_SHEPC Ribosomal RNA large subunit methyltransferase E OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rlmE PE=3 SV=1 13 201 1.0E-23
sp|Q8EHM3|RLME_SHEON Ribosomal RNA large subunit methyltransferase E OS=Shewanella oneidensis (strain MR-1) GN=rlmE PE=3 SV=1 13 201 1.0E-23
sp|Q2IV68|RLME_RHOP2 Ribosomal RNA large subunit methyltransferase E OS=Rhodopseudomonas palustris (strain HaA2) GN=rlmE PE=3 SV=1 13 202 2.0E-23
sp|Q2KC36|RLME_RHIEC Ribosomal RNA large subunit methyltransferase E OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rlmE PE=3 SV=1 13 202 2.0E-23
sp|A4JDA6|RLME_BURVG Ribosomal RNA large subunit methyltransferase E OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rlmE PE=3 SV=1 13 203 2.0E-23
sp|P57463|RLME_BUCAI Ribosomal RNA large subunit methyltransferase E OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rlmE PE=3 SV=1 1 196 2.0E-23
sp|Q0BGJ2|RLME_BURCM Ribosomal RNA large subunit methyltransferase E OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rlmE PE=3 SV=1 13 203 2.0E-23
sp|B1YMW2|RLME_BURA4 Ribosomal RNA large subunit methyltransferase E OS=Burkholderia ambifaria (strain MC40-6) GN=rlmE PE=3 SV=1 13 203 2.0E-23
sp|Q8ZLS7|RLME_SALTY Ribosomal RNA large subunit methyltransferase E OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B4TWE7|RLME_SALSV Ribosomal RNA large subunit methyltransferase E OS=Salmonella schwarzengrund (strain CVM19633) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|A9N744|RLME_SALPB Ribosomal RNA large subunit methyltransferase E OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B4T708|RLME_SALNS Ribosomal RNA large subunit methyltransferase E OS=Salmonella newport (strain SL254) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B4TJ16|RLME_SALHS Ribosomal RNA large subunit methyltransferase E OS=Salmonella heidelberg (strain SL476) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B5REP5|RLME_SALG2 Ribosomal RNA large subunit methyltransferase E OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B5R0H0|RLME_SALEP Ribosomal RNA large subunit methyltransferase E OS=Salmonella enteritidis PT4 (strain P125109) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B5FI23|RLME_SALDC Ribosomal RNA large subunit methyltransferase E OS=Salmonella dublin (strain CT_02021853) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B5F6U7|RLME_SALA4 Ribosomal RNA large subunit methyltransferase E OS=Salmonella agona (strain SL483) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|A9MP28|RLME_SALAR Ribosomal RNA large subunit methyltransferase E OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|A9ACL8|RLME_BURM1 Ribosomal RNA large subunit methyltransferase E OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rlmE PE=3 SV=1 13 203 2.0E-23
sp|C0PZ62|RLME_SALPC Ribosomal RNA large subunit methyltransferase E OS=Salmonella paratyphi C (strain RKS4594) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|Q57JH1|RLME_SALCH Ribosomal RNA large subunit methyltransferase E OS=Salmonella choleraesuis (strain SC-B67) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|Q3YX62|RLME_SHISS Ribosomal RNA large subunit methyltransferase E OS=Shigella sonnei (strain Ss046) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|P0C0S0|RLME_SHIFL Ribosomal RNA large subunit methyltransferase E OS=Shigella flexneri GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|Q0T0A5|RLME_SHIF8 Ribosomal RNA large subunit methyltransferase E OS=Shigella flexneri serotype 5b (strain 8401) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|Q31W56|RLME_SHIBS Ribosomal RNA large subunit methyltransferase E OS=Shigella boydii serotype 4 (strain Sb227) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B2U1Z8|RLME_SHIB3 Ribosomal RNA large subunit methyltransferase E OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B7LR46|RLME_ESCF3 Ribosomal RNA large subunit methyltransferase E OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|Q1R6F9|RLME_ECOUT Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain UTI89 / UPEC) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B1LFS9|RLME_ECOSM Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B6I1Q2|RLME_ECOSE Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain SE11) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B7NDG3|RLME_ECOLU Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|P0C0R7|RLME_ECOLI Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain K12) GN=rlmE PE=1 SV=1 13 201 2.0E-23
sp|B1IQU4|RLME_ECOLC Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|P0C0R9|RLME_ECOL6 Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|Q0TCT1|RLME_ECOL5 Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|A1AG82|RLME_ECOK1 Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O1:K1 / APEC GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|A8A4Z3|RLME_ECOHS Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O9:H4 (strain HS) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B1XGY9|RLME_ECODH Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain K12 / DH10B) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|C4ZSR8|RLME_ECOBW Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B7M085|RLME_ECO8A Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O8 (strain IAI1) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B7N363|RLME_ECO81 Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O81 (strain ED1a) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B7NKP6|RLME_ECO7I Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B5YS68|RLME_ECO5E Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|P0C0R8|RLME_ECO57 Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O157:H7 GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B7LHP2|RLME_ECO55 Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli (strain 55989 / EAEC) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B7MBU8|RLME_ECO45 Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B7UJ72|RLME_ECO27 Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|A7ZS75|RLME_ECO24 Ribosomal RNA large subunit methyltransferase E OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|A8AQ68|RLME_CITK8 Ribosomal RNA large subunit methyltransferase E OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|A0LC14|RLME_MAGMM Ribosomal RNA large subunit methyltransferase E OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rlmE PE=3 SV=1 13 202 2.0E-23
sp|Q0HXS3|RLME_SHESR Ribosomal RNA large subunit methyltransferase E OS=Shewanella sp. (strain MR-7) GN=rlmE PE=3 SV=1 13 201 2.0E-23
sp|B8CKG5|RLME_SHEPW Ribosomal RNA large subunit methyltransferase E OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rlmE PE=3 SV=1 13 201 3.0E-23
sp|Q2YBT1|RLME_NITMU Ribosomal RNA large subunit methyltransferase E OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rlmE PE=3 SV=1 13 199 3.0E-23
sp|C5CKU4|RLME_VARPS Ribosomal RNA large subunit methyltransferase E OS=Variovorax paradoxus (strain S110) GN=rlmE PE=3 SV=1 13 206 3.0E-23
sp|A5WCU8|RLME_PSYWF Ribosomal RNA large subunit methyltransferase E OS=Psychrobacter sp. (strain PRwf-1) GN=rlmE PE=3 SV=1 13 197 3.0E-23
sp|B5BGK3|RLME_SALPK Ribosomal RNA large subunit methyltransferase E OS=Salmonella paratyphi A (strain AKU_12601) GN=rlmE PE=3 SV=1 13 201 3.0E-23
sp|Q5PLC1|RLME_SALPA Ribosomal RNA large subunit methyltransferase E OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rlmE PE=3 SV=1 13 201 3.0E-23
sp|Q8Z3H3|RLME_SALTI Ribosomal RNA large subunit methyltransferase E OS=Salmonella typhi GN=rlmE PE=3 SV=1 13 201 3.0E-23
sp|Q1RHG3|RLME_RICBR Ribosomal RNA large subunit methyltransferase E OS=Rickettsia bellii (strain RML369-C) GN=rlmE PE=3 SV=1 13 197 4.0E-23
sp|A8GV60|RLME_RICB8 Ribosomal RNA large subunit methyltransferase E OS=Rickettsia bellii (strain OSU 85-389) GN=rlmE PE=3 SV=1 13 197 4.0E-23
sp|A4VNP3|RLME_PSEU5 Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas stutzeri (strain A1501) GN=rlmE PE=3 SV=2 13 202 4.0E-23
sp|Q32BF4|RLME_SHIDS Ribosomal RNA large subunit methyltransferase E OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=rlmE PE=3 SV=1 13 201 4.0E-23
sp|B9JSD2|RLME_AGRVS Ribosomal RNA large subunit methyltransferase E OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rlmE PE=3 SV=1 13 202 4.0E-23
sp|Q1D841|RLME_MYXXD Ribosomal RNA large subunit methyltransferase E OS=Myxococcus xanthus (strain DK 1622) GN=rlmE PE=3 SV=1 13 203 4.0E-23
sp|C3MGQ4|RLME_RHISN Ribosomal RNA large subunit methyltransferase E OS=Rhizobium sp. (strain NGR234) GN=rlmE PE=3 SV=1 13 202 4.0E-23
sp|Q3KI92|RLME_PSEPF Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas fluorescens (strain Pf0-1) GN=rlmE PE=3 SV=1 13 202 5.0E-23
sp|A0KNF1|RLME_AERHH Ribosomal RNA large subunit methyltransferase E OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=rlmE PE=3 SV=1 4 201 5.0E-23
sp|A6U6F0|RLME_SINMW Ribosomal RNA large subunit methyltransferase E OS=Sinorhizobium medicae (strain WSM419) GN=rlmE PE=3 SV=1 13 202 5.0E-23
sp|B0KHY6|RLME_PSEPG Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas putida (strain GB-1) GN=rlmE PE=3 SV=1 13 202 5.0E-23
sp|A7MIM8|RLME_CROS8 Ribosomal RNA large subunit methyltransferase E OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rlmE PE=3 SV=2 13 201 6.0E-23
sp|Q1H387|RLME_METFK Ribosomal RNA large subunit methyltransferase E OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rlmE PE=3 SV=1 13 196 6.0E-23
sp|B0VEE9|RLME_ACIBY Ribosomal RNA large subunit methyltransferase E OS=Acinetobacter baumannii (strain AYE) GN=rlmE PE=3 SV=1 13 199 6.0E-23
sp|A3M851|RLME_ACIBT Ribosomal RNA large subunit methyltransferase E OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rlmE PE=3 SV=2 13 199 6.0E-23
sp|B0VSM4|RLME_ACIBS Ribosomal RNA large subunit methyltransferase E OS=Acinetobacter baumannii (strain SDF) GN=rlmE PE=3 SV=1 13 199 6.0E-23
sp|B2HXD3|RLME_ACIBC Ribosomal RNA large subunit methyltransferase E OS=Acinetobacter baumannii (strain ACICU) GN=rlmE PE=3 SV=1 13 199 6.0E-23
sp|B7I636|RLME_ACIB5 Ribosomal RNA large subunit methyltransferase E OS=Acinetobacter baumannii (strain AB0057) GN=rlmE PE=3 SV=1 13 199 6.0E-23
sp|B7GY18|RLME_ACIB3 Ribosomal RNA large subunit methyltransferase E OS=Acinetobacter baumannii (strain AB307-0294) GN=rlmE PE=3 SV=1 13 199 6.0E-23
sp|Q88DV0|RLME_PSEPK Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas putida (strain KT2440) GN=rlmE PE=3 SV=1 13 202 6.0E-23
sp|A5W995|RLME_PSEP1 Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rlmE PE=3 SV=1 13 202 6.0E-23
sp|A0LGZ0|RLME_SYNFM Ribosomal RNA large subunit methyltransferase E OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rlmE PE=3 SV=1 13 196 7.0E-23
sp|Q0HLG9|RLME_SHESM Ribosomal RNA large subunit methyltransferase E OS=Shewanella sp. (strain MR-4) GN=rlmE PE=3 SV=1 13 201 7.0E-23
sp|A0KTY8|RLME_SHESA Ribosomal RNA large subunit methyltransferase E OS=Shewanella sp. (strain ANA-3) GN=rlmE PE=3 SV=1 13 201 7.0E-23
sp|C5BFB0|RLME_EDWI9 Ribosomal RNA large subunit methyltransferase E OS=Edwardsiella ictaluri (strain 93-146) GN=rlmE PE=3 SV=1 13 199 7.0E-23
sp|A9KZX9|RLME_SHEB9 Ribosomal RNA large subunit methyltransferase E OS=Shewanella baltica (strain OS195) GN=rlmE PE=3 SV=1 13 201 7.0E-23
sp|A6WRH7|RLME_SHEB8 Ribosomal RNA large subunit methyltransferase E OS=Shewanella baltica (strain OS185) GN=rlmE PE=3 SV=1 13 201 7.0E-23
sp|A3D7L4|RLME_SHEB5 Ribosomal RNA large subunit methyltransferase E OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rlmE PE=3 SV=1 13 201 7.0E-23
sp|B8E6M4|RLME_SHEB2 Ribosomal RNA large subunit methyltransferase E OS=Shewanella baltica (strain OS223) GN=rlmE PE=3 SV=1 13 201 7.0E-23
sp|Q11L51|RLME_CHESB Ribosomal RNA large subunit methyltransferase E OS=Chelativorans sp. (strain BNC1) GN=rlmE PE=3 SV=1 13 202 8.0E-23
sp|A7IDJ5|RLME_XANP2 Ribosomal RNA large subunit methyltransferase E OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rlmE PE=3 SV=1 13 202 8.0E-23
sp|Q1LSK2|RLME_BAUCH Ribosomal RNA large subunit methyltransferase E OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=rlmE PE=3 SV=1 13 201 8.0E-23
sp|Q13W47|RLME_BURXL Ribosomal RNA large subunit methyltransferase E OS=Burkholderia xenovorans (strain LB400) GN=rlmE PE=3 SV=1 13 203 9.0E-23
sp|A8EXN1|RLME_RICCK Ribosomal RNA large subunit methyltransferase E OS=Rickettsia canadensis (strain McKiel) GN=rlmE PE=3 SV=1 13 197 9.0E-23
sp|Q5GS59|RLME_WOLTR Ribosomal RNA large subunit methyltransferase E OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=rlmE PE=3 SV=1 13 200 1.0E-22
sp|B0TQB0|RLME_SHEHH Ribosomal RNA large subunit methyltransferase E OS=Shewanella halifaxensis (strain HAW-EB4) GN=rlmE PE=3 SV=1 13 201 1.0E-22
sp|A7I848|RLME_METB6 Ribosomal RNA large subunit methyltransferase E OS=Methanoregula boonei (strain 6A8) GN=rlmE PE=3 SV=1 13 202 1.0E-22
sp|A4WEZ0|RLME_ENT38 Ribosomal RNA large subunit methyltransferase E OS=Enterobacter sp. (strain 638) GN=rlmE PE=3 SV=1 13 201 1.0E-22
sp|Q0VSS9|RLME_ALCBS Ribosomal RNA large subunit methyltransferase E OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rlmE PE=3 SV=1 13 201 1.0E-22
sp|Q2SUW0|RLME_BURTA Ribosomal RNA large subunit methyltransferase E OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rlmE PE=3 SV=1 13 203 1.0E-22
sp|C6DKI3|RLME_PECCP Ribosomal RNA large subunit methyltransferase E OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rlmE PE=3 SV=1 13 201 1.0E-22
sp|Q2GKK2|RLME_ANAPZ Ribosomal RNA large subunit methyltransferase E OS=Anaplasma phagocytophilum (strain HZ) GN=rlmE PE=3 SV=1 13 202 1.0E-22
sp|B8GNX9|RLME_THISH Ribosomal RNA large subunit methyltransferase E OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rlmE PE=3 SV=1 13 202 1.0E-22
sp|B1XXG3|RLME_LEPCP Ribosomal RNA large subunit methyltransferase E OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rlmE PE=3 SV=1 13 204 1.0E-22
sp|B5FA72|RLME_VIBFM Ribosomal RNA large subunit methyltransferase E OS=Vibrio fischeri (strain MJ11) GN=rlmE PE=3 SV=1 13 202 2.0E-22
sp|A8H748|RLME_SHEPA Ribosomal RNA large subunit methyltransferase E OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rlmE PE=3 SV=1 13 201 2.0E-22
sp|Q1IF51|RLME_PSEE4 Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas entomophila (strain L48) GN=rlmE PE=3 SV=1 13 202 2.0E-22
sp|A9BML0|RLME_DELAS Ribosomal RNA large subunit methyltransferase E OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rlmE PE=3 SV=1 13 201 2.0E-22
sp|Q28QW4|RLME_JANSC Ribosomal RNA large subunit methyltransferase E OS=Jannaschia sp. (strain CCS1) GN=rlmE PE=3 SV=1 13 202 2.0E-22
sp|Q5E7M3|RLME_VIBF1 Ribosomal RNA large subunit methyltransferase E OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rlmE PE=3 SV=1 13 202 2.0E-22
sp|B3PQL4|RLME_RHIE6 Ribosomal RNA large subunit methyltransferase E OS=Rhizobium etli (strain CIAT 652) GN=rlmE PE=3 SV=1 13 202 2.0E-22
sp|Q8UHR0|RLME_AGRFC Ribosomal RNA large subunit methyltransferase E OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rlmE PE=3 SV=2 13 202 2.0E-22
sp|Q1Q955|RLME_PSYCK Ribosomal RNA large subunit methyltransferase E OS=Psychrobacter cryohalolentis (strain K5) GN=rlmE PE=3 SV=1 13 197 3.0E-22
sp|Q8XZ79|RLME_RALSO Ribosomal RNA large subunit methyltransferase E OS=Ralstonia solanacearum (strain GMI1000) GN=rlmE PE=3 SV=1 13 204 3.0E-22
sp|B6JHM9|RLME_OLICO Ribosomal RNA large subunit methyltransferase E OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rlmE PE=3 SV=1 13 202 4.0E-22
sp|B2SZR9|RLME_BURPP Ribosomal RNA large subunit methyltransferase E OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rlmE PE=3 SV=1 13 203 4.0E-22
sp|Q63V86|RLME_BURPS Ribosomal RNA large subunit methyltransferase E OS=Burkholderia pseudomallei (strain K96243) GN=rlmE PE=3 SV=1 13 203 4.0E-22
sp|A3N853|RLME_BURP6 Ribosomal RNA large subunit methyltransferase E OS=Burkholderia pseudomallei (strain 668) GN=rlmE PE=3 SV=1 13 203 4.0E-22
sp|Q3JTT5|RLME_BURP1 Ribosomal RNA large subunit methyltransferase E OS=Burkholderia pseudomallei (strain 1710b) GN=rlmE PE=3 SV=2 13 203 4.0E-22
sp|A3NTW3|RLME_BURP0 Ribosomal RNA large subunit methyltransferase E OS=Burkholderia pseudomallei (strain 1106a) GN=rlmE PE=3 SV=1 13 203 4.0E-22
sp|A1V319|RLME_BURMS Ribosomal RNA large subunit methyltransferase E OS=Burkholderia mallei (strain SAVP1) GN=rlmE PE=3 SV=2 13 203 4.0E-22
sp|Q62L80|RLME_BURMA Ribosomal RNA large subunit methyltransferase E OS=Burkholderia mallei (strain ATCC 23344) GN=rlmE PE=3 SV=1 13 203 4.0E-22
sp|A2S3Q7|RLME_BURM9 Ribosomal RNA large subunit methyltransferase E OS=Burkholderia mallei (strain NCTC 10229) GN=rlmE PE=3 SV=1 13 203 4.0E-22
sp|A3MIQ3|RLME_BURM7 Ribosomal RNA large subunit methyltransferase E OS=Burkholderia mallei (strain NCTC 10247) GN=rlmE PE=3 SV=1 13 203 4.0E-22
sp|Q2GGT6|RLME_EHRCR Ribosomal RNA large subunit methyltransferase E OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rlmE PE=3 SV=1 13 201 5.0E-22
sp|B5ZR94|RLME_RHILW Ribosomal RNA large subunit methyltransferase E OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rlmE PE=3 SV=1 13 202 5.0E-22
sp|Q4FQX1|RLME_PSYA2 Ribosomal RNA large subunit methyltransferase E OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rlmE PE=3 SV=1 13 197 5.0E-22
sp|Q1ML15|RLME_RHIL3 Ribosomal RNA large subunit methyltransferase E OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rlmE PE=3 SV=1 13 202 6.0E-22
sp|Q7MYY0|RLME_PHOLL Ribosomal RNA large subunit methyltransferase E OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rlmE PE=3 SV=1 13 201 6.0E-22
sp|B1JMH7|RLME_YERPY Ribosomal RNA large subunit methyltransferase E OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rlmE PE=3 SV=1 13 199 8.0E-22
sp|Q66F67|RLME_YERPS Ribosomal RNA large subunit methyltransferase E OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rlmE PE=3 SV=1 13 199 8.0E-22
sp|A4TRJ0|RLME_YERPP Ribosomal RNA large subunit methyltransferase E OS=Yersinia pestis (strain Pestoides F) GN=rlmE PE=3 SV=1 13 199 8.0E-22
sp|Q1CEK6|RLME_YERPN Ribosomal RNA large subunit methyltransferase E OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rlmE PE=3 SV=1 13 199 8.0E-22
sp|Q8ZBB5|RLME_YERPE Ribosomal RNA large subunit methyltransferase E OS=Yersinia pestis GN=rlmE PE=3 SV=1 13 199 8.0E-22
sp|B2K2P8|RLME_YERPB Ribosomal RNA large subunit methyltransferase E OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rlmE PE=3 SV=1 13 199 8.0E-22
sp|Q1CC00|RLME_YERPA Ribosomal RNA large subunit methyltransferase E OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rlmE PE=3 SV=1 13 199 8.0E-22
sp|A7FMS9|RLME_YERP3 Ribosomal RNA large subunit methyltransferase E OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rlmE PE=3 SV=1 13 199 8.0E-22
sp|A8GMD3|RLME_RICAH Ribosomal RNA large subunit methyltransferase E OS=Rickettsia akari (strain Hartford) GN=rlmE PE=3 SV=1 13 196 9.0E-22
sp|A8G900|RLME_SERP5 Ribosomal RNA large subunit methyltransferase E OS=Serratia proteamaculans (strain 568) GN=rlmE PE=3 SV=1 13 201 1.0E-21
sp|A0Q526|RLME_FRATN Ribosomal RNA large subunit methyltransferase E OS=Francisella tularensis subsp. novicida (strain U112) GN=rlmE PE=3 SV=1 13 202 1.0E-21
sp|Q5QXK8|RLME_IDILO Ribosomal RNA large subunit methyltransferase E OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rlmE PE=3 SV=1 13 201 1.0E-21
sp|Q1QSY2|RLME_CHRSD Ribosomal RNA large subunit methyltransferase E OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=rlmE PE=3 SV=1 13 200 1.0E-21
sp|Q2RXU5|RLME_RHORT Ribosomal RNA large subunit methyltransferase E OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rlmE PE=3 SV=1 13 202 1.0E-21
sp|A4IYP4|RLME_FRATW Ribosomal RNA large subunit methyltransferase E OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rlmE PE=3 SV=1 13 202 1.0E-21
sp|Q5NGD3|RLME_FRATT Ribosomal RNA large subunit methyltransferase E OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rlmE PE=3 SV=1 13 202 1.0E-21
sp|B2SF85|RLME_FRATM Ribosomal RNA large subunit methyltransferase E OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rlmE PE=3 SV=1 13 202 1.0E-21
sp|Q14HT5|RLME_FRAT1 Ribosomal RNA large subunit methyltransferase E OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rlmE PE=3 SV=1 13 202 1.0E-21
sp|Q3IE64|RLME_PSEHT Ribosomal RNA large subunit methyltransferase E OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rlmE PE=3 SV=1 13 201 1.0E-21
sp|B2UGQ0|RLME_RALPJ Ribosomal RNA large subunit methyltransferase E OS=Ralstonia pickettii (strain 12J) GN=rlmE PE=3 SV=1 13 204 2.0E-21
sp|Q30YX3|RLME_DESAG Ribosomal RNA large subunit methyltransferase E OS=Desulfovibrio alaskensis (strain G20) GN=rlmE PE=3 SV=1 13 202 2.0E-21
sp|Q0BNB8|RLME_FRATO Ribosomal RNA large subunit methyltransferase E OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rlmE PE=3 SV=1 13 202 3.0E-21
sp|Q2A4Z7|RLME_FRATH Ribosomal RNA large subunit methyltransferase E OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rlmE PE=3 SV=1 13 202 3.0E-21
sp|A7NAC9|RLME_FRATF Ribosomal RNA large subunit methyltransferase E OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rlmE PE=3 SV=1 13 202 3.0E-21
sp|Q6D9B9|RLME_PECAS Ribosomal RNA large subunit methyltransferase E OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rlmE PE=3 SV=1 13 199 3.0E-21
sp|B6END5|RLME_ALISL Ribosomal RNA large subunit methyltransferase E OS=Aliivibrio salmonicida (strain LFI1238) GN=rlmE PE=3 SV=1 13 202 4.0E-21
sp|B1J262|RLME_PSEPW Ribosomal RNA large subunit methyltransferase E OS=Pseudomonas putida (strain W619) GN=rlmE PE=3 SV=1 13 202 4.0E-21
sp|Q2NW30|RLME_SODGM Ribosomal RNA large subunit methyltransferase E OS=Sodalis glossinidius (strain morsitans) GN=rlmE PE=3 SV=1 13 201 4.0E-21
sp|Q983F8|RLME_RHILO Ribosomal RNA large subunit methyltransferase E OS=Rhizobium loti (strain MAFF303099) GN=rlmE PE=3 SV=1 13 202 4.0E-21
sp|C0QX75|RLME_BRAHW Ribosomal RNA large subunit methyltransferase E OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=rlmE PE=3 SV=1 13 201 5.0E-21
sp|B9J9U0|RLME_AGRRK Ribosomal RNA large subunit methyltransferase E OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rlmE PE=3 SV=1 13 204 5.0E-21
sp|Q6F8N1|RLME_ACIAD Ribosomal RNA large subunit methyltransferase E OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rlmE PE=3 SV=1 13 199 6.0E-21
sp|A2SF90|RLME_METPP Ribosomal RNA large subunit methyltransferase E OS=Methylibium petroleiphilum (strain PM1) GN=rlmE PE=3 SV=1 13 202 7.0E-21
sp|A1JIW2|RLME_YERE8 Ribosomal RNA large subunit methyltransferase E OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rlmE PE=3 SV=1 13 199 7.0E-21
sp|A8II77|RLME_AZOC5 Ribosomal RNA large subunit methyltransferase E OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rlmE PE=3 SV=1 13 201 9.0E-21
sp|B2VGT0|RLME_ERWT9 Ribosomal RNA large subunit methyltransferase E OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rlmE PE=3 SV=1 13 201 9.0E-21
sp|Q07LH9|RLME_RHOP5 Ribosomal RNA large subunit methyltransferase E OS=Rhodopseudomonas palustris (strain BisA53) GN=rlmE PE=3 SV=1 13 203 1.0E-20
sp|A1AW32|RLME_RUTMC Ribosomal RNA large subunit methyltransferase E OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rlmE PE=3 SV=1 13 201 1.0E-20
sp|C3PMK3|RLME_RICAE Ribosomal RNA large subunit methyltransferase E OS=Rickettsia africae (strain ESF-5) GN=rlmE PE=3 SV=1 13 197 1.0E-20
sp|Q212R3|RLME_RHOPB Ribosomal RNA large subunit methyltransferase E OS=Rhodopseudomonas palustris (strain BisB18) GN=rlmE PE=3 SV=1 13 201 2.0E-20
sp|A3CVJ3|RLME_METMJ Ribosomal RNA large subunit methyltransferase E OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rlmE PE=3 SV=1 13 202 2.0E-20
sp|A5CX75|RLME_VESOH Ribosomal RNA large subunit methyltransferase E OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rlmE PE=3 SV=1 13 206 2.0E-20
sp|Q7VQM8|RLME_BLOFL Ribosomal RNA large subunit methyltransferase E OS=Blochmannia floridanus GN=rlmE PE=3 SV=1 5 201 2.0E-20
sp|A4YSS3|RLME_BRASO Ribosomal RNA large subunit methyltransferase E OS=Bradyrhizobium sp. (strain ORS278) GN=rlmE PE=3 SV=1 13 207 2.0E-20
sp|Q1QKB6|RLME_NITHX Ribosomal RNA large subunit methyltransferase E OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rlmE PE=3 SV=1 13 202 2.0E-20
sp|Q46Z98|RLME_CUPPJ Ribosomal RNA large subunit methyltransferase E OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rlmE PE=3 SV=1 13 204 3.0E-20
sp|Q89N72|RLME_BRADU Ribosomal RNA large subunit methyltransferase E OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rlmE PE=3 SV=1 13 201 4.0E-20
sp|Q3SQN7|RLME_NITWN Ribosomal RNA large subunit methyltransferase E OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rlmE PE=3 SV=1 13 205 4.0E-20
sp|Q31HG6|RLME_THICR Ribosomal RNA large subunit methyltransferase E OS=Thiomicrospira crunogena (strain XCL-2) GN=rlmE PE=3 SV=1 9 202 4.0E-20
sp|Q2IPT3|RLME_ANADE Ribosomal RNA large subunit methyltransferase E OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rlmE PE=3 SV=1 13 202 5.0E-20
sp|B5ENR5|RLME_ACIF5 Ribosomal RNA large subunit methyltransferase E OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rlmE PE=3 SV=1 5 207 8.0E-20
sp|B7J8G6|RLME_ACIF2 Ribosomal RNA large subunit methyltransferase E OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rlmE PE=3 SV=1 5 207 8.0E-20
sp|A5EHP2|RLME_BRASB Ribosomal RNA large subunit methyltransferase E OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rlmE PE=3 SV=1 13 202 8.0E-20
sp|Q92J64|RLME_RICCN Ribosomal RNA large subunit methyltransferase E OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rlmE PE=3 SV=1 13 197 8.0E-20
sp|Q5P1G0|RLME_AROAE Ribosomal RNA large subunit methyltransferase E OS=Aromatoleum aromaticum (strain EbN1) GN=rlmE PE=3 SV=1 13 202 9.0E-20
sp|C4K7K8|RLME_HAMD5 Ribosomal RNA large subunit methyltransferase E OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rlmE PE=3 SV=1 13 201 1.0E-19
sp|A8GQZ0|RLME_RICRS Ribosomal RNA large subunit methyltransferase E OS=Rickettsia rickettsii (strain Sheila Smith) GN=rlmE PE=3 SV=1 13 197 1.0E-19
sp|B0BWD8|RLME_RICRO Ribosomal RNA large subunit methyltransferase E OS=Rickettsia rickettsii (strain Iowa) GN=rlmE PE=3 SV=1 13 197 1.0E-19
sp|Q0K8Y4|RLME_CUPNH Ribosomal RNA large subunit methyltransferase E OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rlmE PE=3 SV=1 13 202 1.0E-19
sp|B2S3S1|RLME_TREPS Ribosomal RNA large subunit methyltransferase E OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rlmE PE=3 SV=1 11 202 1.0E-19
sp|O83687|RLME_TREPA Ribosomal RNA large subunit methyltransferase E OS=Treponema pallidum (strain Nichols) GN=rlmE PE=3 SV=1 11 202 1.0E-19
sp|C4K0Q4|RLME_RICPU Ribosomal RNA large subunit methyltransferase E OS=Rickettsia peacockii (strain Rustic) GN=rlmE PE=3 SV=1 13 197 1.0E-19
sp|B3R1S2|RLME_CUPTR Ribosomal RNA large subunit methyltransferase E OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rlmE PE=3 SV=1 13 201 2.0E-19
sp|B3QFD2|RLME_RHOPT Ribosomal RNA large subunit methyltransferase E OS=Rhodopseudomonas palustris (strain TIE-1) GN=rlmE PE=3 SV=1 13 202 2.0E-19
sp|Q6N7Q9|RLME_RHOPA Ribosomal RNA large subunit methyltransferase E OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rlmE PE=3 SV=1 13 202 2.0E-19
sp|Q9ZE00|RLME_RICPR Ribosomal RNA large subunit methyltransferase E OS=Rickettsia prowazekii (strain Madrid E) GN=rlmE PE=3 SV=1 13 196 2.0E-19
sp|B8FL12|RLME_DESAA Ribosomal RNA large subunit methyltransferase E OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rlmE PE=3 SV=1 5 196 3.0E-19
sp|Q8P9Y1|RLME_XANCP Ribosomal RNA large subunit methyltransferase E OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rlmE PE=3 SV=2 13 202 3.0E-19
sp|B0RTZ3|RLME_XANCB Ribosomal RNA large subunit methyltransferase E OS=Xanthomonas campestris pv. campestris (strain B100) GN=rlmE PE=3 SV=1 13 202 3.0E-19
sp|Q4UTQ4|RLME_XANC8 Ribosomal RNA large subunit methyltransferase E OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rlmE PE=3 SV=2 13 202 3.0E-19
sp|A4SXL6|RLME_POLSQ Ribosomal RNA large subunit methyltransferase E OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rlmE PE=3 SV=1 13 203 3.0E-19
sp|Q1LLA8|RLME_CUPMC Ribosomal RNA large subunit methyltransferase E OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rlmE PE=3 SV=1 13 202 4.0E-19
sp|A6T081|RLME_JANMA Ribosomal RNA large subunit methyltransferase E OS=Janthinobacterium sp. (strain Marseille) GN=rlmE PE=3 SV=1 13 203 4.0E-19
sp|B8GG79|RLME_METPE Ribosomal RNA large subunit methyltransferase E OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=rlmE PE=3 SV=1 13 200 4.0E-19
sp|Q68XK5|RLME_RICTY Ribosomal RNA large subunit methyltransferase E OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rlmE PE=3 SV=1 13 196 5.0E-19
sp|A1VC40|RLME_DESVV Ribosomal RNA large subunit methyltransferase E OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rlmE PE=3 SV=1 13 202 5.0E-19
sp|Q729T9|RLME_DESVH Ribosomal RNA large subunit methyltransferase E OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rlmE PE=3 SV=1 13 202 5.0E-19
sp|Q97C13|RLME_THEVO Ribosomal RNA large subunit methyltransferase E OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rlmE PE=1 SV=1 11 203 6.0E-19
sp|A5EXB6|RLME_DICNV Ribosomal RNA large subunit methyltransferase E OS=Dichelobacter nodosus (strain VCS1703A) GN=rlmE PE=3 SV=1 19 200 7.0E-19
sp|A5IHX0|RLME_LEGPC Ribosomal RNA large subunit methyltransferase E OS=Legionella pneumophila (strain Corby) GN=rlmE PE=3 SV=2 13 200 2.0E-18
sp|Q9CPY0|MRM2_MOUSE rRNA methyltransferase 2, mitochondrial OS=Mus musculus GN=Ftsj2 PE=1 SV=1 13 202 2.0E-18
sp|A7H9A5|RLME_ANADF Ribosomal RNA large subunit methyltransferase E OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rlmE PE=3 SV=1 13 200 2.0E-18
sp|Q5ZRT1|RLME_LEGPH Ribosomal RNA large subunit methyltransferase E OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rlmE PE=3 SV=2 13 200 2.0E-18
sp|Q5X1A0|RLME_LEGPA Ribosomal RNA large subunit methyltransferase E OS=Legionella pneumophila (strain Paris) GN=rlmE PE=3 SV=1 13 200 2.0E-18
sp|Q89AF1|RLME_BUCBP Ribosomal RNA large subunit methyltransferase E OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rlmE PE=3 SV=1 25 201 3.0E-18
sp|Q1MRQ0|RLME_LAWIP Ribosomal RNA large subunit methyltransferase E OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rlmE PE=3 SV=1 13 201 3.0E-18
sp|Q15VJ6|RLME_PSEA6 Ribosomal RNA large subunit methyltransferase E OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rlmE PE=3 SV=1 13 201 3.0E-18
sp|C6C068|RLME_DESAD Ribosomal RNA large subunit methyltransferase E OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=rlmE PE=3 SV=1 13 202 4.0E-18
sp|Q5WT13|RLME_LEGPL Ribosomal RNA large subunit methyltransferase E OS=Legionella pneumophila (strain Lens) GN=rlmE PE=3 SV=1 13 200 4.0E-18
sp|Q820A2|RLME_NITEU Ribosomal RNA large subunit methyltransferase E OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rlmE PE=3 SV=1 13 196 6.0E-18
sp|B4SRA0|RLME_STRM5 Ribosomal RNA large subunit methyltransferase E OS=Stenotrophomonas maltophilia (strain R551-3) GN=rlmE PE=3 SV=1 13 202 7.0E-18
sp|A6VPC2|RLME_ACTSZ Ribosomal RNA large subunit methyltransferase E OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rlmE PE=3 SV=1 13 201 7.0E-18
sp|B2FKA1|RLME_STRMK Ribosomal RNA large subunit methyltransferase E OS=Stenotrophomonas maltophilia (strain K279a) GN=rlmE PE=3 SV=1 13 202 7.0E-18
sp|Q9VDT6|MRM2_DROME rRNA methyltransferase 2, mitochondrial OS=Drosophila melanogaster GN=CG11447 PE=2 SV=1 13 202 1.0E-17
sp|Q47YJ3|RLME_COLP3 Ribosomal RNA large subunit methyltransferase E OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=rlmE PE=3 SV=1 13 202 1.0E-17
sp|A4G4B0|RLME_HERAR Ribosomal RNA large subunit methyltransferase E OS=Herminiimonas arsenicoxydans GN=rlmE PE=3 SV=1 13 203 1.0E-17
sp|Q0AHC6|RLME_NITEC Ribosomal RNA large subunit methyltransferase E OS=Nitrosomonas eutropha (strain C91) GN=rlmE PE=3 SV=1 13 196 1.0E-17
sp|Q65TZ0|RLME_MANSM Ribosomal RNA large subunit methyltransferase E OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rlmE PE=3 SV=1 13 202 1.0E-17
sp|A9FQE4|RLME_SORC5 Ribosomal RNA large subunit methyltransferase E OS=Sorangium cellulosum (strain So ce56) GN=rlmE PE=3 SV=1 6 196 1.0E-17
sp|B0BUF3|RLME_ACTPJ Ribosomal RNA large subunit methyltransferase E OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rlmE PE=3 SV=1 13 202 2.0E-17
sp|B3H123|RLME_ACTP7 Ribosomal RNA large subunit methyltransferase E OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rlmE PE=3 SV=1 13 202 2.0E-17
sp|A3MZW0|RLME_ACTP2 Ribosomal RNA large subunit methyltransferase E OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rlmE PE=3 SV=1 13 202 2.0E-17
sp|B8F4C0|RLME_HAEPS Ribosomal RNA large subunit methyltransferase E OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rlmE PE=3 SV=1 13 202 2.0E-17
sp|Q9CNJ3|RLME_PASMU Ribosomal RNA large subunit methyltransferase E OS=Pasteurella multocida (strain Pm70) GN=rlmE PE=3 SV=1 13 202 2.0E-17
sp|Q6L1E2|RLME_PICTO Ribosomal RNA large subunit methyltransferase E OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rlmE PE=3 SV=1 10 196 2.0E-17
sp|Q4QKJ2|RLME_HAEI8 Ribosomal RNA large subunit methyltransferase E OS=Haemophilus influenzae (strain 86-028NP) GN=rlmE PE=3 SV=1 13 202 4.0E-17
sp|B0U1F2|RLME_XYLFM Ribosomal RNA large subunit methyltransferase E OS=Xylella fastidiosa (strain M12) GN=rlmE PE=3 SV=1 13 199 5.0E-17
sp|Q9PH52|RLME_XYLFA Ribosomal RNA large subunit methyltransferase E OS=Xylella fastidiosa (strain 9a5c) GN=rlmE PE=3 SV=1 13 199 5.0E-17
sp|Q8K9G7|RLME_BUCAP Ribosomal RNA large subunit methyltransferase E OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rlmE PE=3 SV=1 13 196 5.0E-17
sp|B8DNJ4|RLME_DESVM Ribosomal RNA large subunit methyltransferase E OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rlmE PE=3 SV=1 9 207 7.0E-17
sp|Q5GYL7|RLME_XANOR Ribosomal RNA large subunit methyltransferase E OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rlmE PE=3 SV=2 13 199 9.0E-17
sp|B2SUB8|RLME_XANOP Ribosomal RNA large subunit methyltransferase E OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rlmE PE=3 SV=1 13 199 9.0E-17
sp|Q2P1M0|RLME_XANOM Ribosomal RNA large subunit methyltransferase E OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rlmE PE=3 SV=1 13 199 9.0E-17
sp|Q0I2R1|RLME_HAES1 Ribosomal RNA large subunit methyltransferase E OS=Haemophilus somnus (strain 129Pt) GN=rlmE PE=3 SV=1 13 200 1.0E-16
sp|Q3BUR8|RLME_XANC5 Ribosomal RNA large subunit methyltransferase E OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rlmE PE=3 SV=1 13 199 1.0E-16
sp|Q8PLQ8|RLME_XANAC Ribosomal RNA large subunit methyltransferase E OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rlmE PE=3 SV=1 13 199 1.0E-16
sp|Q7VLF2|RLME_HAEDU Ribosomal RNA large subunit methyltransferase E OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rlmE PE=3 SV=1 13 202 1.0E-16
sp|Q87F66|RLME_XYLFT Ribosomal RNA large subunit methyltransferase E OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rlmE PE=3 SV=1 13 199 2.0E-16
sp|B2I696|RLME_XYLF2 Ribosomal RNA large subunit methyltransferase E OS=Xylella fastidiosa (strain M23) GN=rlmE PE=3 SV=1 13 199 2.0E-16
sp|P45162|RLME_HAEIN Ribosomal RNA large subunit methyltransferase E OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rlmE PE=3 SV=1 13 202 2.0E-16
sp|Q9UI43|MRM2_HUMAN rRNA methyltransferase 2, mitochondrial OS=Homo sapiens GN=FTSJ2 PE=1 SV=1 13 196 2.0E-16
sp|Q6AJ42|RLME_DESPS Ribosomal RNA large subunit methyltransferase E OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rlmE PE=3 SV=1 13 205 3.0E-16
sp|P78860|MRM2_SCHPO rRNA methyltransferase 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrm2 PE=2 SV=2 13 197 6.0E-16
sp|Q73L97|RLME_TREDE Ribosomal RNA large subunit methyltransferase E OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rlmE PE=3 SV=1 6 202 6.0E-16
sp|B5RRD2|RLME_BORRA Ribosomal RNA large subunit methyltransferase E OS=Borrelia recurrentis (strain A1) GN=rlmE PE=3 SV=1 12 200 8.0E-16
sp|B5RLD9|RLME_BORDL Ribosomal RNA large subunit methyltransferase E OS=Borrelia duttonii (strain Ly) GN=rlmE PE=3 SV=1 12 200 8.0E-16
sp|C0QGP2|RLME_DESAH Ribosomal RNA large subunit methyltransferase E OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rlmE PE=3 SV=1 13 199 8.0E-16
sp|Q9HIH4|RLME_THEAC Ribosomal RNA large subunit methyltransferase E OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rlmE PE=3 SV=1 13 202 3.0E-15
sp|Q3YRW8|RLME_EHRCJ Ribosomal RNA large subunit methyltransferase E OS=Ehrlichia canis (strain Jake) GN=rlmE PE=3 SV=1 35 201 5.0E-14
sp|Q493U3|RLME_BLOPB Ribosomal RNA large subunit methyltransferase E OS=Blochmannia pennsylvanicus (strain BPEN) GN=rlmE PE=3 SV=1 5 198 2.0E-13
sp|P53123|MRM2_YEAST rRNA methyltransferase 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRM2 PE=1 SV=1 13 117 3.0E-13
sp|Q8KTR0|RLME_TREPR Ribosomal RNA large subunit methyltransferase E OS=Tremblaya princeps GN=rlmE PE=3 SV=1 13 199 6.0E-13
sp|Q057J5|RLME_BUCCC Ribosomal RNA large subunit methyltransferase E OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rlmE PE=3 SV=1 13 201 1.0E-12
sp|A8ZT18|RLME_DESOH Ribosomal RNA large subunit methyltransferase E OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=rlmE PE=3 SV=1 8 200 2.0E-12
sp|Q0SNJ8|RLME_BORAP Ribosomal RNA large subunit methyltransferase E OS=Borrelia afzelii (strain PKo) GN=rlmE PE=3 SV=1 13 200 5.0E-12
sp|Q661V2|RLME_BORBP Ribosomal RNA large subunit methyltransferase E OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rlmE PE=3 SV=1 13 200 8.0E-12
sp|B7J1P0|RLME_BORBZ Ribosomal RNA large subunit methyltransferase E OS=Borrelia burgdorferi (strain ZS7) GN=rlmE PE=3 SV=1 13 200 3.0E-11
sp|O51293|RLME_BORBU Ribosomal RNA large subunit methyltransferase E OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rlmE PE=3 SV=2 13 200 3.0E-11
sp|Q8D2X0|RLME_WIGBR Ribosomal RNA large subunit methyltransferase E OS=Wigglesworthia glossinidia brevipalpis GN=rlmE PE=3 SV=1 13 201 5.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0032259 methylation Yes
GO:0005634 nucleus Yes
GO:0008168 methyltransferase activity Yes
GO:0006364 rRNA processing Yes
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0043226 organelle No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0034470 ncRNA processing No
GO:0110165 cellular anatomical entity No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0005575 cellular_component No
GO:0043227 membrane-bounded organelle No
GO:0016070 RNA metabolic process No
GO:0006396 RNA processing No
GO:0016072 rRNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0003824 catalytic activity No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2515 0.8659 0.0718 0.0118 0.0703 0.0079 0.0405 0.0063 0.017 0.0015

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup791
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7569
Ophiocordyceps australis map64 (Brazil) OphauB2|3746
Ophiocordyceps camponoti-floridani Ophcf2|04744
Ophiocordyceps camponoti-rufipedis Ophun1|5
Ophiocordyceps kimflemingae Ophio5|4144 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3185
Ophiocordyceps subramaniannii Hirsu2|3186

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4144
MAIQKKHGKSRLDKWYKLAKEKGYRARAAFKLIQLNKKYGFLEKSKVLLDLCAAPGSWCQVAAEVMPVNSLIVGV
DLAPIKPIARVYTFQSDITTDVCRATIRQHFKTWKADTVLHDGAPNVGTAWAQDSFNQAELALQATKLAAEFLVE
GGTFVTKVFRSKDYNPLLWVLNQLFTKVEATKPPSSRNVSAEIFVVCRGFKAPNRLDPRLLDPKAVFAELSGATP
NHEAKVYNPEIKKRKREGYDEGDHTQFKQVPASEFIQTVDPIAILGDCNRLSFDQPVGGDVALTALERLPDTTPE
IRDCCADLQVLGRKDFKLLLRWRLKVRKIFGLGSKASTGPETAEEVAEVESMDEELKIQEELQSMRDKDQSKRKR
EKRRENERKQREIVRMQLNMVAPMDIGMEESGPMGEGSIFSLKQIDKSDALRRLSRGKMISVSNQERNRHEGIEQ
PEENDGQYDIDEDRLERQLDSMYDNYRERKAESDAKYQAKKAREERNDDEWEGLSDNMKSQDSDSSELDEEDSSD
EDSDQTPLSNLVRDLDGTEAISGGLSKRAAAFFSQNIFRGIADTVQQTVAGGVGEGDRTSSEKMLKQKAGRARTS
GIEPLTSHAVEPHDEQGKHNGNFEMVKRTDIDDWEESTLLPDGRPDIDIVTAEAMTLAHQLATGQKTSYDAADDG
FNKYSLRDRDGLPEWFLDDESKHDKPIKPITKAAAQAIQEKMRAFNARPIKKVREAKARKKFKAAQRLENLKKKS
SLLVNDEGMTEKEKAESIAKMLSKASRRKPTQPAKVVVARGPNRGIQGRPKGVRGRYRMVDPRMKKELRAHKRIA
QRKKR
Coding >Ophio5|4144
ATGGCGATTCAGAAGAAACATGGCAAAAGCCGTCTGGACAAATGGTACAAACTCGCAAAGGAGAAGGGCTACCGT
GCTAGAGCTGCCTTTAAGCTCATTCAATTGAACAAGAAGTATGGCTTCTTGGAAAAGAGCAAAGTCCTTCTGGAT
CTTTGCGCCGCGCCTGGCTCATGGTGTCAGGTAGCAGCAGAGGTAATGCCAGTCAACAGCCTCATAGTCGGCGTT
GATCTGGCACCGATTAAGCCCATTGCCAGAGTCTATACCTTTCAGAGCGACATCACCACCGACGTTTGTCGCGCC
ACCATTCGACAGCATTTCAAGACATGGAAGGCCGATACGGTCCTCCACGATGGTGCCCCTAATGTCGGTACTGCC
TGGGCGCAAGATTCCTTCAACCAGGCTGAGCTTGCCCTCCAAGCCACGAAGTTGGCGGCCGAGTTTCTGGTTGAA
GGCGGCACCTTCGTCACAAAAGTTTTCCGATCGAAAGACTATAACCCGCTGCTTTGGGTGCTGAACCAGCTCTTT
ACCAAGGTGGAAGCCACAAAGCCCCCTTCGTCTCGGAATGTGTCAGCCGAGATTTTTGTCGTTTGCCGAGGCTTT
AAGGCCCCCAATCGGCTCGACCCCCGTCTATTGGACCCAAAGGCTGTGTTTGCAGAATTATCGGGGGCCACACCC
AACCATGAGGCGAAGGTGTACAACCCCGAGATCAAAAAGCGCAAGCGTGAAGGTTACGACGAGGGTGATCACACT
CAGTTCAAACAAGTCCCCGCGAGCGAATTCATTCAAACCGTTGATCCAATCGCTATACTCGGAGACTGCAACAGG
CTTTCCTTCGACCAACCGGTTGGCGGAGACGTTGCGCTGACCGCGCTGGAAAGACTCCCTGATACGACACCCGAG
ATCAGAGACTGTTGTGCAGACCTCCAAGTTCTGGGGCGTAAGGACTTCAAGCTGCTTTTAAGATGGCGACTGAAA
GTGAGAAAGATCTTCGGACTCGGCTCGAAAGCATCAACCGGCCCGGAAACGGCAGAGGAAGTGGCGGAGGTCGAG
TCCATGGACGAAGAACTCAAGATACAAGAAGAGCTGCAATCGATGAGGGATAAAGATCAATCAAAGAGAAAGCGG
GAAAAACGCAGGGAAAATGAGCGCAAGCAGCGAGAAATCGTCAGGATGCAGCTTAATATGGTCGCACCCATGGAT
ATTGGCATGGAGGAAAGCGGCCCGATGGGCGAAGGGTCCATATTCTCACTCAAACAAATCGACAAGTCCGATGCT
CTGCGTCGTCTTTCGCGCGGGAAAATGATCTCAGTGTCAAATCAGGAAAGGAATCGGCACGAAGGAATAGAGCAG
CCTGAAGAAAATGACGGTCAGTACGATATCGACGAAGACCGACTCGAACGACAGCTCGACTCCATGTACGACAAC
TATCGTGAGCGAAAAGCCGAGTCTGATGCTAAGTATCAGGCCAAGAAGGCGAGAGAGGAACGCAACGATGACGAA
TGGGAAGGGCTCTCGGACAATATGAAGTCCCAGGATAGCGATTCGAGCGAGTTGGATGAAGAGGATTCGTCAGAC
GAAGATAGCGACCAAACCCCCTTAAGCAACCTAGTGCGGGATCTCGATGGCACAGAGGCAATCAGCGGTGGCTTG
TCGAAAAGAGCCGCGGCGTTTTTCAGTCAGAACATCTTTCGAGGAATTGCCGACACTGTTCAACAAACAGTGGCT
GGGGGGGTTGGCGAGGGGGATAGAACCTCGAGCGAAAAGATGTTGAAACAGAAGGCCGGCCGAGCACGAACCTCT
GGTATCGAACCCCTGACATCTCACGCAGTCGAGCCACATGATGAGCAGGGAAAACACAATGGGAATTTCGAGATG
GTGAAACGTACGGACATTGACGACTGGGAAGAGTCGACACTGCTTCCTGATGGAAGACCTGATATTGACATTGTC
ACGGCCGAGGCGATGACTTTGGCACATCAGCTCGCTACTGGTCAGAAGACATCATATGATGCCGCAGACGATGGA
TTTAACAAGTACTCCTTACGCGATCGCGATGGGCTGCCTGAATGGTTTCTTGACGACGAGTCTAAGCACGACAAG
CCGATAAAACCTATCACCAAGGCTGCTGCGCAGGCGATCCAGGAGAAGATGCGGGCTTTCAATGCTCGACCCATC
AAAAAGGTTCGGGAGGCCAAGGCTCGCAAGAAGTTCAAGGCGGCGCAAAGGCTGGAAAACCTCAAGAAGAAGTCT
TCTCTACTCGTCAATGACGAGGGTATGACGGAGAAGGAAAAGGCCGAGAGCATCGCAAAGATGCTCAGCAAGGCT
TCTCGCAGGAAGCCTACGCAACCTGCAAAGGTGGTGGTGGCTAGAGGTCCAAACAGGGGCATCCAAGGTCGGCCA
AAGGGTGTCAGGGGCCGTTATCGCATGGTAGATCCGAGGATGAAGAAGGAGCTGCGGGCTCATAAGAGGATCGCG
CAGCGCAAAAAGCGG
Transcript >Ophio5|4144
ATGGCGATTCAGAAGAAACATGGCAAAAGCCGTCTGGACAAATGGTACAAACTCGCAAAGGAGAAGGGCTACCGT
GCTAGAGCTGCCTTTAAGCTCATTCAATTGAACAAGAAGTATGGCTTCTTGGAAAAGAGCAAAGTCCTTCTGGAT
CTTTGCGCCGCGCCTGGCTCATGGTGTCAGGTAGCAGCAGAGGTAATGCCAGTCAACAGCCTCATAGTCGGCGTT
GATCTGGCACCGATTAAGCCCATTGCCAGAGTCTATACCTTTCAGAGCGACATCACCACCGACGTTTGTCGCGCC
ACCATTCGACAGCATTTCAAGACATGGAAGGCCGATACGGTCCTCCACGATGGTGCCCCTAATGTCGGTACTGCC
TGGGCGCAAGATTCCTTCAACCAGGCTGAGCTTGCCCTCCAAGCCACGAAGTTGGCGGCCGAGTTTCTGGTTGAA
GGCGGCACCTTCGTCACAAAAGTTTTCCGATCGAAAGACTATAACCCGCTGCTTTGGGTGCTGAACCAGCTCTTT
ACCAAGGTGGAAGCCACAAAGCCCCCTTCGTCTCGGAATGTGTCAGCCGAGATTTTTGTCGTTTGCCGAGGCTTT
AAGGCCCCCAATCGGCTCGACCCCCGTCTATTGGACCCAAAGGCTGTGTTTGCAGAATTATCGGGGGCCACACCC
AACCATGAGGCGAAGGTGTACAACCCCGAGATCAAAAAGCGCAAGCGTGAAGGTTACGACGAGGGTGATCACACT
CAGTTCAAACAAGTCCCCGCGAGCGAATTCATTCAAACCGTTGATCCAATCGCTATACTCGGAGACTGCAACAGG
CTTTCCTTCGACCAACCGGTTGGCGGAGACGTTGCGCTGACCGCGCTGGAAAGACTCCCTGATACGACACCCGAG
ATCAGAGACTGTTGTGCAGACCTCCAAGTTCTGGGGCGTAAGGACTTCAAGCTGCTTTTAAGATGGCGACTGAAA
GTGAGAAAGATCTTCGGACTCGGCTCGAAAGCATCAACCGGCCCGGAAACGGCAGAGGAAGTGGCGGAGGTCGAG
TCCATGGACGAAGAACTCAAGATACAAGAAGAGCTGCAATCGATGAGGGATAAAGATCAATCAAAGAGAAAGCGG
GAAAAACGCAGGGAAAATGAGCGCAAGCAGCGAGAAATCGTCAGGATGCAGCTTAATATGGTCGCACCCATGGAT
ATTGGCATGGAGGAAAGCGGCCCGATGGGCGAAGGGTCCATATTCTCACTCAAACAAATCGACAAGTCCGATGCT
CTGCGTCGTCTTTCGCGCGGGAAAATGATCTCAGTGTCAAATCAGGAAAGGAATCGGCACGAAGGAATAGAGCAG
CCTGAAGAAAATGACGGTCAGTACGATATCGACGAAGACCGACTCGAACGACAGCTCGACTCCATGTACGACAAC
TATCGTGAGCGAAAAGCCGAGTCTGATGCTAAGTATCAGGCCAAGAAGGCGAGAGAGGAACGCAACGATGACGAA
TGGGAAGGGCTCTCGGACAATATGAAGTCCCAGGATAGCGATTCGAGCGAGTTGGATGAAGAGGATTCGTCAGAC
GAAGATAGCGACCAAACCCCCTTAAGCAACCTAGTGCGGGATCTCGATGGCACAGAGGCAATCAGCGGTGGCTTG
TCGAAAAGAGCCGCGGCGTTTTTCAGTCAGAACATCTTTCGAGGAATTGCCGACACTGTTCAACAAACAGTGGCT
GGGGGGGTTGGCGAGGGGGATAGAACCTCGAGCGAAAAGATGTTGAAACAGAAGGCCGGCCGAGCACGAACCTCT
GGTATCGAACCCCTGACATCTCACGCAGTCGAGCCACATGATGAGCAGGGAAAACACAATGGGAATTTCGAGATG
GTGAAACGTACGGACATTGACGACTGGGAAGAGTCGACACTGCTTCCTGATGGAAGACCTGATATTGACATTGTC
ACGGCCGAGGCGATGACTTTGGCACATCAGCTCGCTACTGGTCAGAAGACATCATATGATGCCGCAGACGATGGA
TTTAACAAGTACTCCTTACGCGATCGCGATGGGCTGCCTGAATGGTTTCTTGACGACGAGTCTAAGCACGACAAG
CCGATAAAACCTATCACCAAGGCTGCTGCGCAGGCGATCCAGGAGAAGATGCGGGCTTTCAATGCTCGACCCATC
AAAAAGGTTCGGGAGGCCAAGGCTCGCAAGAAGTTCAAGGCGGCGCAAAGGCTGGAAAACCTCAAGAAGAAGTCT
TCTCTACTCGTCAATGACGAGGGTATGACGGAGAAGGAAAAGGCCGAGAGCATCGCAAAGATGCTCAGCAAGGCT
TCTCGCAGGAAGCCTACGCAACCTGCAAAGGTGGTGGTGGCTAGAGGTCCAAACAGGGGCATCCAAGGTCGGCCA
AAGGGTGTCAGGGGCCGTTATCGCATGGTAGATCCGAGGATGAAGAAGGAGCTGCGGGCTCATAAGAGGATCGCG
CAGCGCAAAAAGCGGTGA
Gene >Ophio5|4144
ATGGCGATTCAGAAGAAACATGGCAAAAGCCGTCTGGACAAATGGTACAAACTCGCAAAGGAGAAGGGCTACCGT
GCTAGAGCTGCCTTTAAGCTCATTCAATTGAACAAGAAGTATGGCTTCTTGGAAAAGAGCAAAGTCCTTCTGGAT
CTTTGCGCCGCGCCTGGCGTGAGTCGGACTCTCGCTCTTACTAAACCTTTCTTGACATGGAAGCTAATACGGGGT
AAAGTCATGGTGTCAGGTAGCAGCAGAGGTAATGCCAGTCAACAGCCTCATAGTCGGCGTTGATCTGGCACCGAT
TAAGCCCATTGCCAGAGTCTATACCTTTCAGAGCGACATCACCACCGACGTTTGTCGCGCCACCATTCGACAGCA
TTTCAAGACATGGAAGGCCGATACGGTCCTCCACGATGGTGCCCCTAATGTCGGTACTGCCTGGGCGCAAGATTC
CTTCAACCAGGCTGAGCTTGCCCTCCAAGCCACGAAGTTGGCGGCCGAGTTTCTGGTTGAAGGCGGCACCTTCGT
CACAAAAGTTTTCCGATCGAAAGACTATAACCCGCTGCTTTGGGTGCTGAACCAGCTCTTTACCAAGGTGGAAGC
CACAAAGCCCCCTTCGTCTCGGAATGTGTCAGCCGAGATTTTTGTCGTTTGCCGAGGCTTTAAGGCCCCCAATCG
GCTCGACCCCCGTCTATTGGACCCAAAGGCTGTGTTTGCAGAATTATCGGGGGCCACACCCAACCATGAGGCGAA
GGTGTACAACCCCGAGATCAAAAAGCGCAAGCGTGAAGGTTACGACGAGGGTGATCACACTCAGTTCAAACAAGT
CCCCGCGAGCGAATTCATTCAAACCGTTGATCCAATCGCTATACTCGGAGACTGCAACAGGCTTTCCTTCGACCA
ACCGGTTGGCGGAGACGTTGCGCTGACCGCGCTGGAAAGACTCCCTGATACGACACCCGAGATCAGAGACTGTTG
TGCAGACCTCCAAGTTCTGGGGCGTAAGGACTTCAAGCTGCTTTTAAGATGGCGACTGAAAGTGAGAAAGATCTT
CGGACTCGGCTCGAAAGCATCAACCGGCCCGGAAACGGCAGAGGAAGTGGCGGAGGTCGAGTCCATGGACGAAGA
ACTCAAGATACAAGAAGAGCTGCAATCGATGAGGGATAAAGATCAATCAAAGAGAAAGCGGGAAAAACGCAGGGA
AAATGAGCGCAAGCAGCGAGAAATCGTCAGGATGCAGCTTAATATGGTCGCACCCATGGATATTGGCATGGAGGA
AAGCGGCCCGATGGGCGAAGGGTCCATATTCTCACTCAAACAAATCGACAAGTCCGATGCTCTGCGTCGTCTTTC
GCGCGGGAAAATGATCTCAGTGTCAAATCAGGAAAGGAATCGGCACGAAGGAATAGAGCAGCCTGAAGAAAATGA
CGGTCAGTACGATATCGACGAAGACCGACTCGAACGACAGCTCGACTCCATGTACGACAACTATCGTGAGCGAAA
AGCCGAGTCTGATGCTAAGTATCAGGCCAAGAAGGCGAGAGAGGAACGCAACGATGACGAATGGGAAGGGCTCTC
GGACAATATGAAGTCCCAGGATAGCGATTCGAGCGAGTTGGATGAAGAGGATTCGTCAGACGAAGATAGCGACCA
AACCCCCTTAAGCAACCTAGTGCGGGATCTCGATGGCACAGAGGCAATCAGCGGTGGCTTGTCGAAAAGAGCCGC
GGCGTTTTTCAGTCAGAACATCTTTCGAGGAATTGCCGACACTGTTCAACAAACAGTGGCTGGGGGGGTTGGCGA
GGGGGATAGAACCTCGAGCGAAAAGATGTTGAAACAGAAGGCCGGCCGAGCACGAACCTCTGGTATCGAACCCCT
GACATCTCACGCAGTCGAGCCACATGATGAGCAGGGAAAACACAATGGGAATTTCGAGATGGTGAAACGTACGGA
CATTGACGACTGGGAAGAGTCGACACTGCTTCCTGATGGAAGACCTGGTGAGTATGCCTCGAGATTTCCATCGAG
GTTGTGCTGCTTGCTCCCGGTAAATCGATACTAACCAAAGCCTTTCAGATATTGACATTGTCACGGCCGAGGCGA
TGACTTTGGCACATCAGCTCGCTACTGGTCAGAAGACATCATATGATGCCGCAGACGATGGATTTAACAAGTACT
CCTTACGCGATCGCGATGGGCTGCCTGAATGGTTTCTTGACGACGAGTCTAAGCACGACAAGCCGATAAAACCTA
TCACCAAGGCTGCTGCGCAGGCGATCCAGGAGAAGATGCGGGCTTTCAATGCTCGACCCATCAAAAAGGTTCGGG
AGGCCAAGGCTCGCAAGAAGTTCAAGGCGGCGCAAAGGCTGGAAAACCTCAAGAAGAAGTCTTCTCTACTCGTCA
ATGACGAGGGTATGACGGAGAAGGAAAAGGCCGAGAGCATCGCAAAGATGCTCAGCAAGGCTTCTCGCAGGAAGC
CTACGCAACCTGCAAAGGTGGTGGTGGCTAGAGGTCCAAACAGGGGCATCCAAGGTCGGCCAAAGGGTGTCAGGG
GCCGTTATCGCATGGTAGATCCGAGGATGAAGAAGGAGCTGCGGGCTCATAAGAGGATCGCGCAGCGCAAAAAGC
GGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail