Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4142
Gene name
Locationscaffold_325:12943..22656
Strand+
Gene length (bp)9713
Transcript length (bp)9642
Coding sequence length (bp)9639
Protein length (aa) 3213

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06650 SHR-BD SHR-binding domain of vacuolar-sorting associated protein 13 1.0E-92 2279 2560
PF16910 VPS13_mid_rpt Repeating coiled region of VPS13 1.0E-90 592 828
PF16908 VPS13 Vacuolar sorting-associated protein 13, N-terminal 7.2E-85 139 378
PF16909 VPS13_C Vacuolar-sorting-associated 13 protein C-terminal 2.3E-70 2809 2984
PF12624 Chorein_N N-terminal region of Chorein or VPS13 1.8E-39 2 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87319|VP13A_SCHPO Vacuolar protein sorting-associated protein 13a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13a PE=3 SV=2 1 3157 0.0E+00
sp|O42926|VP13B_SCHPO Vacuolar protein sorting-associated protein 13b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13b PE=2 SV=1 926 3142 0.0E+00
sp|Q07878|VPS13_YEAST Vacuolar protein sorting-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS13 PE=1 SV=1 1 3207 0.0E+00
sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 1 1326 8.0E-100
sp|Q8BX70|VP13C_MOUSE Vacuolar protein sorting-associated protein 13C OS=Mus musculus GN=Vps13c PE=1 SV=2 1 1383 6.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87319|VP13A_SCHPO Vacuolar protein sorting-associated protein 13a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13a PE=3 SV=2 1 3157 0.0E+00
sp|O42926|VP13B_SCHPO Vacuolar protein sorting-associated protein 13b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13b PE=2 SV=1 926 3142 0.0E+00
sp|Q07878|VPS13_YEAST Vacuolar protein sorting-associated protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS13 PE=1 SV=1 1 3207 0.0E+00
sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 1 1326 8.0E-100
sp|Q8BX70|VP13C_MOUSE Vacuolar protein sorting-associated protein 13C OS=Mus musculus GN=Vps13c PE=1 SV=2 1 1383 6.0E-98
sp|Q5H8C4|VP13A_MOUSE Vacuolar protein sorting-associated protein 13A OS=Mus musculus GN=Vps13a PE=1 SV=1 1 1331 3.0E-97
sp|Q54LB8|VP13A_DICDI Putative vacuolar protein sorting-associated protein 13A OS=Dictyostelium discoideum GN=vps13A PE=2 SV=1 1 1058 5.0E-95
sp|O42926|VP13B_SCHPO Vacuolar protein sorting-associated protein 13b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps13b PE=2 SV=1 1 819 2.0E-88
sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 1 1383 2.0E-88
sp|Q54LB8|VP13A_DICDI Putative vacuolar protein sorting-associated protein 13A OS=Dictyostelium discoideum GN=vps13A PE=2 SV=1 2169 3148 5.0E-87
sp|Q555C6|VP13B_DICDI Putative vacuolar protein sorting-associated protein 13B OS=Dictyostelium discoideum GN=vps13B PE=3 SV=1 1 684 1.0E-77
sp|Q96RL7|VP13A_HUMAN Vacuolar protein sorting-associated protein 13A OS=Homo sapiens GN=VPS13A PE=1 SV=2 1814 3153 4.0E-77
sp|Q55EI3|VP13E_DICDI Putative vacuolar protein sorting-associated protein 13E OS=Dictyostelium discoideum GN=vps13E PE=3 SV=1 2053 3174 4.0E-76
sp|Q55FG3|VP13C_DICDI Putative vacuolar protein sorting-associated protein 13C OS=Dictyostelium discoideum GN=tipC PE=3 SV=1 1 823 6.0E-71
sp|Q55FG3|VP13C_DICDI Putative vacuolar protein sorting-associated protein 13C OS=Dictyostelium discoideum GN=tipC PE=3 SV=1 2543 3180 1.0E-70
sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=2 1 819 1.0E-65
sp|Q8BX70|VP13C_MOUSE Vacuolar protein sorting-associated protein 13C OS=Mus musculus GN=Vps13c PE=1 SV=2 2675 3159 1.0E-62
sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 2675 3159 1.0E-61
sp|Q5H8C4|VP13A_MOUSE Vacuolar protein sorting-associated protein 13A OS=Mus musculus GN=Vps13a PE=1 SV=1 2675 3153 2.0E-60
sp|Q9BGZ0|VP13A_MACFA Vacuolar protein sorting-associated protein 13A (Fragment) OS=Macaca fascicularis GN=VPS13A PE=2 SV=1 2651 3111 6.0E-57
sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associated protein 13F OS=Dictyostelium discoideum GN=vps13F PE=3 SV=1 2552 3130 1.0E-52
sp|Q555C6|VP13B_DICDI Putative vacuolar protein sorting-associated protein 13B OS=Dictyostelium discoideum GN=vps13B PE=3 SV=1 2653 3172 2.0E-51
sp|Q8BX70|VP13C_MOUSE Vacuolar protein sorting-associated protein 13C OS=Mus musculus GN=Vps13c PE=1 SV=2 967 2468 1.0E-48
sp|Q54LN2|VP13D_DICDI Putative vacuolar protein sorting-associated protein 13D OS=Dictyostelium discoideum GN=vps13D PE=3 SV=1 2810 3172 6.0E-48
sp|Q709C8|VP13C_HUMAN Vacuolar protein sorting-associated protein 13C OS=Homo sapiens GN=VPS13C PE=1 SV=1 566 2468 9.0E-42
sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associated protein 13F OS=Dictyostelium discoideum GN=vps13F PE=3 SV=1 138 420 2.0E-41
sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=2 2597 3113 1.0E-38
sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=2 1977 2558 9.0E-22
sp|Q55EI3|VP13E_DICDI Putative vacuolar protein sorting-associated protein 13E OS=Dictyostelium discoideum GN=vps13E PE=3 SV=1 202 707 1.0E-20
sp|Q7Z7G8|VP13B_HUMAN Vacuolar protein sorting-associated protein 13B OS=Homo sapiens GN=VPS13B PE=1 SV=2 2859 3067 2.0E-19
sp|Q80TY5|VP13B_MOUSE Vacuolar protein sorting-associated protein 13B OS=Mus musculus GN=Vps13b PE=1 SV=2 2859 3067 2.0E-19
sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associated protein 13F OS=Dictyostelium discoideum GN=vps13F PE=3 SV=1 1 123 3.0E-19
sp|Q54LN2|VP13D_DICDI Putative vacuolar protein sorting-associated protein 13D OS=Dictyostelium discoideum GN=vps13D PE=3 SV=1 2370 2772 2.0E-17
sp|Q55EI3|VP13E_DICDI Putative vacuolar protein sorting-associated protein 13E OS=Dictyostelium discoideum GN=vps13E PE=3 SV=1 1 193 4.0E-14
sp|Q5H8C4|VP13A_MOUSE Vacuolar protein sorting-associated protein 13A OS=Mus musculus GN=Vps13a PE=1 SV=1 1848 2427 5.0E-14
sp|Q54LN2|VP13D_DICDI Putative vacuolar protein sorting-associated protein 13D OS=Dictyostelium discoideum GN=vps13D PE=3 SV=1 1 89 1.0E-12
sp|Q5THJ4|VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=2 985 1295 3.0E-11
sp|Q7Z7G8|VP13B_HUMAN Vacuolar protein sorting-associated protein 13B OS=Homo sapiens GN=VPS13B PE=1 SV=2 1 143 3.0E-11
sp|Q80TY5|VP13B_MOUSE Vacuolar protein sorting-associated protein 13B OS=Mus musculus GN=Vps13b PE=1 SV=2 1 143 4.0E-11
sp|Q86K84|VP13L_DICDI Vacuolar protein sorting-associated protein 13-like protein OS=Dictyostelium discoideum GN=vps13l PE=3 SV=1 2881 3079 1.0E-10
sp|Q54KX3|VP13F_DICDI Putative vacuolar protein sorting-associated protein 13F OS=Dictyostelium discoideum GN=vps13F PE=3 SV=1 585 711 3.0E-10
sp|Q54LN2|VP13D_DICDI Putative vacuolar protein sorting-associated protein 13D OS=Dictyostelium discoideum GN=vps13D PE=3 SV=1 143 317 6.0E-10
sp|Q555C6|VP13B_DICDI Putative vacuolar protein sorting-associated protein 13B OS=Dictyostelium discoideum GN=vps13B PE=3 SV=1 2367 2560 2.0E-08
sp|Q54PG5|GACC_DICDI Rho GTPase-activating protein gacC OS=Dictyostelium discoideum GN=gacC PE=3 SV=1 2995 3076 2.0E-08
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Lysosome/Vacuole 0.4925 0.2818 0.0708 0.1604 0.6287 0.0757 0.4082 0.668 0.4972 0.0112

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2095
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3932
Ophiocordyceps australis map64 (Brazil) OphauB2|7982
Ophiocordyceps camponoti-floridani Ophcf2|00644
Ophiocordyceps camponoti-rufipedis Ophun1|2027
Ophiocordyceps kimflemingae Ophio5|4142 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2462

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4142
MLEGLAAGLLNRFLGMYVQNFDPTQLKVGIWSGDVKLRNLELRREALDQLKLPINVVEGHLGELTLVIPWSNLRG
APVKVFVEDVFLLASPKEEAEYDQQEEEQRSQRLKMEKLDSAELLKERNREGMSPEEQQKNQSFTQSLVTKIVDN
LQITVKNIHVRYEDSISAPGHPFALGLTLEEFSAVSTDGEWKPTFIQNSTAVTNKLATLGALAVYWNTDTELMGS
GREAALPPEEAMPHRDMVAKFRTLINTTATSDHQFILKPVSGQAKIELNKSGDVVAPKFKVNLLFEEIGLVLDDH
QYRDALMMADLFHYFIRHQEYRALKPKGVRPDQDPRAWFQFAGNAVLGKIHERNRTWSWDFFKERRDDRIRYIEL
FKKKKAQQQLSPDEEESLVALEWKLDYEDLRFWRSLARNQLKKENAEALKRQTQQLEHQGWMSWIWGSKPQGKIE
KNEENTQMTEEQRKELYDMIDWDEKTALAETIDVPREAVKLCIEASLGTGSFTLRQSSHGKAARDLLGLYFDVFK
AKALQRKDSLLANISLGGLRVEDGTTPDSLYPEIVRVKDAPETEPRKRLSLLELERSSDEPFFQFEVEQNPIERE
GDVAVIGKLKPLEIVWNPNFVVGIVDFFRPPERHMESITALMESAGATVEGIREQTRAGLEFALEEHKTINAELD
LQAPLIMVPFSITTRESTCVIVDAGHIHVNSQLVDKGTMKEIQSKQRQTYSEEDFKRLESVMYDKFIVKLTSTQV
LIGPSIEETKAQLMGRTEGSQLHVVERINVDFVVETSILPKAPNLTKFRVSGHLPMLHASVSDSKYKNLMKIIDV
AIPKLGGSEQNEAPKPGEGGQPPVPTPQEQAREPARPRLASNSSSRSRRRSQWERRQSAGFPFLQPPSAVVLDDM
DDDQDDFEDASDGADGEQLKIQQRSFEFNFKVDTLKGSLYRSDPDRVKPDALLVELVAERFDLAFYTRLYDMSAE
VSLGAVSVDDFVDNPPAEFKSIVSSGDSDDLQEGRSLVHVKYMDVKRQSPEFMPVYEGVKTNISASVSTINLVVT
RKTLLTLLDFILVTFAGGNNDQEQSRPAITDSDGDHDEVAVESAKQNADSGSIRVKVDLKGIRLILNNDGIRLAT
LSLTEADAGIFLRGKTMRISAKLGDLSLVDDVNLGVSRESNLRKLVTIQGDDLADFRYETFDPDNEQAYPGYDSA
VYLRAGSVKVNFVEEPFRKIIDFVVKFGRMQALYNAARQAAVTRANQMQQSPSRFKFDVVVKTPIVVFPRLMVSG
SPARDLLTAYLGEIYVQNEFAPLDEENDCRIAMKISMGIRKIRLTSDFYYEDGRSEELEMIDQVDLGLSITYAEH
KPGVLRPDTEIEASMSDIKLRLTQHQLKFLMEISKAVPAAFAGDDSGGDEEASQLVGEETLRRARTASADNGSGP
DQRAVDLGPELKSPTDTWTQLDLVFRVNTIGLELVMAPQDGPVGDLAASSLSRFSLDETKVKTRMMSDGSLEAEL
LIRSFTIYDSRPKGVNKFRRIMSSSNKESQQLMASVTMAGGKERNMIAMATIDSPRVIFALDYLFAIQTFATEGL
TVDDSGPLDDESTDETPDGSESADSLRVSSTKAGRSRSQATSLRRSESGSGQLQKGEASMSLALRINLVDAQVIL
IANPLRSNSEAIVLGIRQVLLSQQNALTFQVSEMGMFLCVMDRFETSRLRIIDDFSIQLNMDTSRPSLTSYRVDV
EPLIIRLSLRDILLVLQIITKAGELSGNGKEPAKETPAEQKSKQLRGAGNKTRAPSARAQSTVAKTKANQAVVAK
GGASSTTTTGQSAAPRHEDLYATLQGMRIVLIGDLHELPILDVGVKEFTATAENWSSNLKAEAAIHTYTNVYNFS
KSSWEPLIEPWQVGLGVARESASGILSVDVASKKTLDITITTATIALASKSLDFLTTQENVLDNPRWSDAPYRIK
NYTGFAVVMHSRSPSSEEPIDLRLEDGEEAPWTFEDWEKMRENLLTEAVQNDVGIRLEGSGFDTVKNVRVNREGE
FLYTLRPKTDNVTHRLCVDVRVGSDNVKDVTLRSPLLVENATQIPVELGIYDVQEGHLLKIEKIAPGEARPAPVG
AVYEKRVIVRPDSGFGYQWSRDQLWWRDLLKRPTKQLVCKGETGESFYFQAHADFDKTNPLSKTYPSMTIKLSAP
VTLENLLPYDFKYRIYDRNTKRDWSNFLRKGGVSPVHMVELSHLLLLSVDMQDTMFKPSDFSIINPGNNDDFRKE
NRLVVKDEQGLTLHLSLQYFKVPKSGGAFKISVYSPYVVLNKTGLDMRIRAKSFLQQSKAAAGQFPVVQTASQDR
PKALPLMFSFGNDEHQNRALLKVDESEWSKPQSFDAVGSTSEVVLNSTSKQREIHLGMTVQSGDGKYKMTKVVTL
APRFVLVNKLGEEILVRESSSSDYMTVKAGVLHPLHFMQKSAVKQLCLRFPGVDDHWTSPFNIADVGTTHVKMAK
AGQRQRLVRVEILTEESTIFLHMSIEDKHWPFSMRNESDTEFSFYQANPNVEGDDDEDRSGWKPVRYRLPPRSVM
PYAWDFPAAKFREVIISANGKERHVKLAEMGNQIPMKFVGAGGEHKIIDINVAADGPTQTLILSNFRASKSMFKP
AALSRTKTGPEAFEVKDQGTGATLLAQLKLSGIGVSLINAQLKELAYVTLREVQLRFSDSPLIQTMSLAVKWIQI
DNQLYGGIFPIILYPSVVPKRANEVEAHPSLHAMVSRVKDDSYGVVYIKYATMLLQQMTVDLDEDFVFALLDFSN
IPGASWAAAEPASGRLCDEDIGIPEPSRQQSGQDMYFEVLNIQPMQLDLSFVRTERVNAEDKTSTRNPIMFFLNV
MTMAIGNVNDAPIRFNALMLDNVRVSRAVLVQNMSSHYSQEVMYQIHKILGSADFLGNPVGLFNNISSGVTDIFY
EPYQGLILSDRPEEFGIGIARGAVSFAKKTVYGFSDSFSKFTGSLGKGLAAASLDKQFQDRRRITKARNRPKHAL
YGVAAGANSLLTSVASGVGGLARKPLEGAEQEGALGFFKGVGKGVLGLATKPAVGVLDMASNVSEGIRNTTTVFD
GSELDRTRLPRFMANDGIVRPYGAREALGQFWLKQVDNGKYFDEQYVGHLELPREDMVVMVTYARILLIRSRRLT
SEWDVKLKDVQTVAKERTGVSLTLRGGTNGPFIPVGGGSERAYLYRMIGVAAEEFNRRFRGAE
Coding >Ophio5|4142
ATGCTGGAGGGGCTCGCTGCCGGCCTGCTCAATCGCTTCCTGGGCATGTACGTCCAGAACTTCGATCCCACCCAG
CTCAAGGTCGGCATCTGGTCTGGAGATGTGAAGTTACGCAACCTCGAGCTCCGGCGCGAGGCCCTTGACCAGCTC
AAGCTGCCCATCAACGTCGTCGAGGGCCATCTCGGCGAGCTGACGCTCGTCATCCCGTGGTCCAACCTGCGCGGC
GCCCCGGTCAAGGTATTCGTCGAGGACGTCTTTCTGCTTGCCAGCCCCAAGGAAGAGGCCGAATATGACCAGCAG
GAAGAGGAGCAGCGAAGCCAGCGGCTCAAGATGGAGAAACTCGACAGCGCCGAGCTGCTCAAGGAACGGAATCGA
GAGGGCATGAGTCCCGAGGAGCAGCAGAAGAACCAGAGCTTTACGCAGAGCCTCGTCACCAAGATTGTCGATAAC
CTGCAAATCACCGTCAAGAACATCCATGTCCGATACGAAGACTCCATTTCCGCCCCCGGCCATCCCTTTGCCCTC
GGCCTTACGCTCGAGGAGTTCTCAGCCGTCAGCACCGACGGCGAGTGGAAGCCGACTTTTATACAAAACTCCACC
GCCGTCACCAACAAGTTGGCTACGCTCGGCGCCCTGGCCGTGTATTGGAACACCGACACAGAACTCATGGGCAGC
GGGCGCGAGGCTGCGCTACCGCCAGAAGAGGCCATGCCTCATCGCGACATGGTGGCCAAGTTTCGCACCCTCATC
AACACAACTGCCACCTCGGACCATCAGTTCATCCTGAAGCCCGTCAGTGGGCAGGCCAAGATTGAGCTCAACAAG
TCGGGCGACGTCGTGGCCCCCAAGTTCAAGGTCAACCTGCTATTCGAGGAAATCGGCCTCGTGCTCGACGACCAC
CAGTATCGCGATGCCCTGATGATGGCCGATCTGTTCCACTACTTCATCCGCCACCAGGAATACAGGGCGCTCAAG
CCCAAGGGCGTCCGACCTGACCAGGATCCCCGGGCTTGGTTTCAATTCGCAGGCAACGCCGTGCTCGGAAAGATC
CACGAGCGGAATCGCACATGGTCCTGGGACTTTTTCAAGGAGCGCCGTGACGATCGCATCCGATACATCGAACTC
TTCAAGAAGAAGAAAGCGCAGCAGCAACTGTCACCGGACGAGGAAGAGAGTCTCGTGGCTTTGGAGTGGAAGCTG
GACTACGAAGACTTGCGGTTCTGGCGCTCTCTGGCCCGGAATCAACTGAAGAAGGAAAACGCAGAGGCACTGAAA
AGACAGACCCAGCAACTTGAGCACCAGGGCTGGATGTCGTGGATCTGGGGCTCGAAGCCCCAGGGAAAGATTGAG
AAGAACGAAGAAAACACTCAGATGACCGAGGAGCAGCGCAAGGAGCTGTACGACATGATCGACTGGGATGAAAAG
ACGGCTCTGGCGGAGACCATCGACGTTCCGCGCGAGGCCGTCAAGCTGTGCATCGAGGCTTCCCTCGGCACCGGG
AGCTTCACCCTCAGGCAGAGCAGTCACGGAAAGGCAGCAAGAGATCTTTTGGGCTTGTACTTTGACGTCTTCAAA
GCCAAGGCCCTGCAGCGCAAGGACTCTTTGCTCGCCAACATTAGTCTCGGGGGACTGCGAGTCGAGGACGGCACA
ACGCCAGACAGTCTGTATCCTGAGATTGTGCGAGTCAAGGACGCCCCCGAGACGGAGCCGCGCAAGAGGCTGTCC
TTGCTGGAGCTGGAGAGGAGCAGTGACGAGCCCTTCTTTCAGTTCGAGGTGGAGCAGAACCCGATCGAGCGCGAG
GGCGACGTTGCAGTCATCGGCAAGCTGAAGCCCCTCGAAATCGTCTGGAACCCCAATTTCGTCGTCGGCATCGTC
GACTTCTTCAGACCGCCCGAGAGGCACATGGAGTCCATCACGGCCCTCATGGAGAGCGCTGGCGCTACCGTCGAG
GGAATCAGAGAGCAGACGCGCGCAGGGCTCGAGTTTGCCCTCGAGGAACACAAGACGATCAATGCCGAGCTGGAC
CTACAGGCGCCCCTCATCATGGTCCCTTTCAGCATTACCACCAGAGAATCCACCTGCGTCATTGTCGACGCCGGC
CATATCCACGTCAACAGCCAGCTGGTGGACAAGGGCACCATGAAGGAGATACAGTCCAAGCAGCGGCAGACGTAC
AGCGAGGAGGACTTTAAGCGGCTGGAATCGGTCATGTACGACAAATTCATCGTCAAGCTCACCTCCACCCAGGTC
CTCATCGGGCCCTCCATCGAGGAGACCAAGGCGCAGCTGATGGGGAGAACGGAGGGCTCTCAGCTGCACGTGGTC
GAGAGGATCAACGTTGACTTTGTCGTGGAGACGTCGATTCTGCCCAAGGCCCCCAACCTGACCAAGTTCAGGGTG
TCTGGCCACCTGCCGATGCTTCATGCCTCGGTGTCGGACTCCAAGTACAAGAACCTGATGAAAATCATCGACGTG
GCGATCCCTAAACTCGGAGGGAGCGAGCAGAATGAGGCCCCCAAGCCTGGGGAGGGCGGGCAGCCCCCAGTGCCG
ACACCGCAGGAGCAGGCGAGGGAACCCGCGAGACCCCGGCTTGCTAGCAACAGCTCGAGTAGGTCTCGGCGGAGG
TCGCAGTGGGAGCGTCGGCAGTCGGCTGGCTTCCCCTTTCTGCAGCCGCCAAGCGCTGTTGTGCTCGACGACATG
GACGATGACCAAGACGACTTCGAGGACGCCTCAGACGGCGCAGACGGGGAGCAGCTCAAGATCCAGCAGCGGAGC
TTCGAGTTCAACTTCAAAGTCGACACCCTCAAGGGCTCGCTCTACCGCAGCGACCCGGACCGCGTGAAGCCTGAC
GCCCTACTGGTCGAGCTGGTGGCCGAGCGCTTCGACCTCGCCTTCTACACGAGGCTCTACGACATGTCTGCCGAG
GTGTCTCTCGGCGCCGTGTCCGTGGATGACTTTGTCGACAACCCCCCTGCCGAATTCAAGTCTATCGTCTCGTCC
GGCGACAGCGACGATCTCCAGGAGGGACGGAGTCTTGTCCACGTCAAGTACATGGATGTCAAGCGACAGTCGCCC
GAGTTTATGCCCGTGTACGAGGGAGTCAAGACAAACATTAGTGCCTCCGTATCGACCATCAACCTCGTCGTAACG
AGGAAGACGCTCCTGACGCTCCTCGACTTCATCCTCGTCACCTTTGCCGGAGGTAACAACGACCAGGAGCAGAGC
CGACCGGCCATCACCGACTCGGACGGCGATCACGACGAGGTGGCCGTGGAATCGGCGAAGCAGAATGCAGACTCG
GGTTCCATCAGGGTCAAGGTGGACTTGAAAGGGATCAGGCTCATTCTCAACAACGACGGCATAAGGCTGGCGACG
CTGTCGCTCACCGAGGCCGACGCCGGCATATTCCTCCGGGGAAAGACGATGCGAATATCGGCAAAGTTGGGAGAT
TTGTCCCTCGTCGACGACGTCAATCTGGGTGTATCCAGAGAATCCAACCTACGGAAGCTCGTCACCATCCAGGGC
GACGACCTCGCCGATTTCCGCTATGAGACGTTTGACCCGGATAACGAGCAGGCGTATCCAGGTTACGACAGTGCC
GTCTATCTGCGTGCCGGGTCGGTCAAGGTGAACTTTGTCGAGGAGCCGTTCCGCAAAATCATCGACTTCGTTGTC
AAGTTTGGCAGGATGCAAGCCCTGTACAACGCCGCGCGACAGGCTGCCGTCACACGCGCCAACCAGATGCAGCAG
AGTCCGAGCAGGTTCAAGTTCGACGTCGTCGTGAAGACGCCTATTGTCGTCTTTCCGCGCTTGATGGTGTCCGGC
TCGCCCGCGCGGGACCTTTTGACGGCATATTTGGGTGAGATCTATGTGCAGAATGAGTTTGCGCCGCTGGACGAG
GAAAATGATTGTCGAATCGCTATGAAGATATCGATGGGTATAAGGAAGATTCGACTCACGTCCGACTTTTACTAC
GAGGACGGTAGATCGGAAGAGCTGGAGATGATCGACCAAGTCGACCTCGGACTCAGCATCACCTACGCCGAGCAT
AAGCCTGGCGTTTTGCGTCCAGACACGGAAATCGAAGCCTCAATGTCAGACATCAAGCTCAGACTCACGCAGCAC
CAGCTCAAGTTCCTCATGGAGATTTCCAAAGCAGTTCCCGCTGCGTTCGCCGGTGATGACAGCGGCGGCGACGAG
GAAGCTAGCCAGCTTGTCGGCGAGGAAACACTGCGACGCGCAAGAACCGCGTCGGCAGACAATGGTTCCGGCCCC
GACCAGCGCGCCGTGGATCTCGGCCCCGAGTTGAAGTCGCCTACGGATACGTGGACGCAGTTGGACTTGGTCTTC
CGGGTCAATACCATCGGTCTCGAACTCGTCATGGCTCCGCAGGACGGGCCCGTGGGCGACTTGGCCGCCTCCAGC
CTATCGCGCTTCTCGCTCGACGAAACCAAAGTCAAGACTCGGATGATGTCTGATGGCTCGCTCGAAGCCGAGCTA
CTCATTCGCTCCTTTACCATCTACGACAGCCGTCCAAAGGGGGTAAACAAGTTCCGCCGCATCATGAGCTCATCC
AACAAGGAGTCCCAGCAGCTCATGGCCAGCGTCACCATGGCTGGCGGTAAAGAGCGCAACATGATTGCCATGGCG
ACCATCGACAGTCCTCGCGTCATCTTTGCGCTCGACTACCTCTTCGCTATTCAGACCTTTGCCACCGAGGGCCTG
ACAGTGGACGATTCCGGCCCGCTGGACGATGAAAGCACCGACGAGACGCCGGACGGCTCGGAATCGGCCGATTCC
TTGAGGGTCTCGTCCACCAAGGCCGGGCGCTCCAGGTCGCAGGCGACGTCTCTGCGGCGCAGCGAGTCGGGCTCG
GGCCAGTTGCAGAAGGGAGAGGCCTCGATGAGTTTAGCATTACGGATCAACCTCGTTGACGCGCAGGTCATACTC
ATTGCCAACCCGCTGAGGTCGAATTCTGAAGCTATCGTCCTGGGCATTCGGCAGGTGCTTCTCTCTCAGCAGAAC
GCGCTCACGTTCCAAGTCTCGGAAATGGGCATGTTTCTATGTGTAATGGACAGGTTCGAGACGTCGCGCCTCAGG
ATCATCGACGACTTTTCGATTCAGTTGAACATGGACACGTCACGGCCATCTCTGACAAGCTATCGCGTCGACGTC
GAGCCCCTCATCATCCGGCTGTCCCTGCGAGACATCCTCCTCGTGCTCCAGATCATCACCAAAGCTGGGGAGCTC
TCAGGCAATGGGAAGGAGCCCGCAAAGGAGACGCCGGCGGAGCAAAAGTCGAAGCAGCTGAGGGGCGCCGGCAAC
AAGACAAGAGCCCCCAGCGCCCGCGCTCAGTCAACCGTGGCAAAGACGAAAGCGAACCAGGCCGTTGTCGCCAAA
GGAGGAGCTTCTTCGACGACGACGACGGGTCAATCCGCCGCTCCGAGGCATGAGGATCTTTATGCTACGCTGCAA
GGTATGCGCATCGTACTGATCGGAGACCTGCACGAGCTGCCCATTCTCGATGTAGGAGTCAAGGAGTTCACGGCG
ACGGCGGAGAATTGGTCGTCGAATCTGAAAGCCGAGGCGGCCATACACACGTACACAAACGTCTACAACTTTTCG
AAATCCAGCTGGGAGCCTTTGATCGAGCCATGGCAGGTCGGCCTCGGCGTGGCAAGGGAGTCGGCGTCGGGCATA
CTGTCAGTCGACGTGGCGTCGAAGAAGACGCTCGACATCACCATCACGACGGCGACGATTGCGCTGGCCTCCAAG
TCGCTCGACTTTCTGACGACGCAGGAAAACGTGTTGGATAACCCGCGTTGGAGCGACGCGCCGTACCGCATCAAG
AATTACACGGGCTTCGCCGTCGTGATGCACTCGCGGAGCCCCAGCAGCGAGGAGCCCATCGATCTGCGACTCGAA
GACGGGGAGGAGGCGCCGTGGACGTTTGAAGACTGGGAGAAGATGCGTGAGAACCTGCTGACGGAAGCCGTGCAA
AACGACGTGGGCATCAGGCTGGAGGGCAGTGGTTTCGACACGGTCAAGAACGTACGGGTGAACCGAGAGGGCGAG
TTTCTCTACACTCTGCGGCCCAAGACGGACAACGTGACGCATCGGCTATGCGTGGACGTGCGTGTCGGGTCTGAC
AACGTCAAGGATGTCACGCTTCGGTCCCCGCTACTTGTCGAGAACGCGACGCAGATCCCCGTCGAGCTCGGCATC
TACGACGTCCAGGAAGGCCACCTCCTCAAGATTGAGAAGATTGCGCCGGGGGAAGCGAGGCCGGCTCCGGTGGGC
GCCGTGTACGAGAAGAGGGTCATTGTCCGTCCAGACAGCGGCTTCGGCTACCAATGGAGCAGAGACCAGCTCTGG
TGGAGAGATCTGCTCAAACGGCCGACCAAGCAGCTCGTCTGCAAGGGGGAGACGGGCGAATCCTTTTACTTTCAG
GCCCACGCCGACTTTGACAAGACCAACCCGTTATCCAAGACGTACCCCTCGATGACGATCAAACTCTCGGCACCA
GTCACTCTCGAAAATCTCTTGCCGTACGACTTCAAGTACAGGATCTACGACAGGAATACCAAGAGGGACTGGTCC
AACTTCCTACGCAAGGGTGGCGTGAGCCCCGTCCACATGGTGGAGCTCTCTCACCTCCTACTCCTGAGCGTCGAT
ATGCAGGACACCATGTTCAAGCCGAGTGACTTCTCCATCATCAATCCCGGGAATAATGACGACTTTCGGAAGGAG
AACCGGCTCGTGGTCAAGGACGAGCAAGGGCTGACACTGCATCTGAGCCTGCAATACTTCAAGGTGCCCAAGAGC
GGAGGCGCGTTCAAGATCAGCGTGTACAGCCCCTATGTCGTGTTGAACAAGACGGGACTCGACATGCGGATCCGC
GCCAAGAGCTTCCTACAGCAGTCCAAGGCGGCGGCCGGTCAATTTCCCGTGGTACAGACGGCCAGCCAAGACCGG
CCCAAGGCGCTGCCGTTGATGTTCTCGTTTGGAAACGACGAACATCAGAACCGGGCGCTGCTCAAGGTGGACGAG
TCGGAATGGAGCAAGCCACAGAGTTTCGACGCGGTGGGGAGCACGTCGGAGGTGGTGCTAAACTCGACTTCGAAG
CAGAGGGAGATTCATCTGGGCATGACGGTGCAATCGGGCGACGGCAAGTACAAGATGACCAAGGTGGTGACGCTG
GCGCCGCGGTTCGTGCTGGTCAACAAGCTGGGCGAGGAGATTTTGGTGCGGGAGTCGAGCTCGTCAGACTACATG
ACGGTCAAGGCCGGGGTGTTGCATCCGCTGCACTTTATGCAGAAGTCGGCGGTGAAGCAGCTGTGCCTACGCTTC
CCGGGCGTCGACGACCACTGGACTTCGCCCTTCAACATCGCCGACGTGGGGACGACGCACGTCAAGATGGCCAAG
GCCGGGCAGCGGCAGCGGCTGGTGAGGGTCGAGATCCTTACCGAGGAGTCGACCATCTTCCTGCACATGAGCATC
GAGGACAAGCATTGGCCCTTTTCGATGCGCAACGAGAGCGACACCGAGTTCTCCTTTTACCAGGCCAACCCCAAC
GTGGAAGGGGACGACGACGAGGACCGGAGCGGATGGAAGCCCGTGCGGTACCGGCTGCCGCCGCGGAGCGTGATG
CCGTACGCGTGGGACTTTCCGGCGGCCAAGTTCCGCGAGGTCATCATCTCGGCCAACGGCAAGGAGCGGCACGTC
AAGCTGGCCGAGATGGGCAACCAGATCCCGATGAAGTTCGTCGGAGCGGGAGGGGAGCACAAGATCATCGACATC
AACGTGGCGGCCGACGGACCGACGCAGACGCTGATCCTCAGCAACTTCCGGGCGAGCAAGAGCATGTTCAAGCCG
GCGGCGCTGTCGCGGACCAAGACGGGGCCCGAGGCGTTCGAGGTCAAGGACCAGGGCACGGGGGCGACGCTGTTG
GCGCAGCTGAAGCTGTCGGGCATCGGCGTCTCGCTCATCAACGCGCAGCTCAAGGAGCTGGCATACGTGACGCTG
CGCGAGGTGCAGCTGCGGTTCAGCGACTCGCCCCTGATCCAGACCATGTCGCTGGCGGTCAAGTGGATCCAGATC
GACAACCAGCTGTACGGCGGCATCTTCCCCATCATCCTCTACCCGAGCGTGGTGCCGAAGCGGGCCAACGAGGTG
GAGGCGCACCCGTCGCTGCACGCCATGGTCAGCCGGGTCAAGGACGACTCGTACGGGGTGGTGTACATCAAGTAC
GCGACGATGCTGCTGCAGCAGATGACGGTGGACCTGGACGAGGACTTTGTCTTTGCCCTGCTCGACTTCTCCAAC
ATCCCCGGCGCGAGCTGGGCGGCGGCCGAGCCGGCGTCGGGCCGGCTGTGCGACGAGGACATTGGCATCCCCGAG
CCGTCGCGGCAGCAGTCCGGGCAGGACATGTACTTTGAGGTGCTCAACATTCAGCCGATGCAGCTGGACCTCAGC
TTCGTCCGGACGGAGCGGGTCAACGCCGAGGACAAGACGTCGACGCGGAACCCCATCATGTTCTTCCTCAACGTC
ATGACCATGGCCATTGGCAACGTCAACGACGCGCCGATCCGGTTCAACGCGCTGATGCTGGACAACGTGAGGGTG
TCGCGGGCGGTGCTGGTGCAGAACATGTCGAGCCACTACAGCCAGGAGGTCATGTACCAGATCCACAAGATCCTC
GGCTCGGCCGACTTCCTCGGCAACCCGGTCGGGCTGTTCAACAACATCTCGTCGGGCGTGACGGACATCTTTTAC
GAGCCCTACCAGGGGCTCATACTGTCGGACCGGCCCGAGGAGTTTGGCATCGGCATCGCGCGCGGGGCCGTGTCG
TTTGCCAAGAAGACGGTCTACGGCTTCAGCGACAGCTTCTCCAAGTTCACGGGCAGCCTGGGCAAGGGCCTGGCG
GCGGCCTCGCTCGACAAGCAGTTCCAGGACCGGCGGCGCATCACCAAGGCGCGCAACCGGCCCAAGCACGCGCTG
TACGGGGTGGCGGCGGGCGCCAACTCGCTGCTGACGAGCGTGGCGTCGGGCGTGGGCGGGCTGGCGCGCAAGCCG
CTGGAGGGGGCCGAGCAGGAGGGCGCCCTGGGCTTCTTCAAGGGCGTGGGCAAGGGCGTGCTCGGGCTGGCGACG
AAGCCGGCGGTGGGGGTGCTGGACATGGCGAGCAACGTCAGCGAGGGCATCCGCAACACGACGACGGTCTTTGAC
GGGTCGGAGCTGGACCGGACGCGGCTGCCGCGCTTCATGGCCAACGACGGCATCGTCAGGCCGTACGGGGCGCGG
GAGGCGCTGGGCCAGTTCTGGCTGAAGCAGGTCGACAACGGCAAGTACTTTGACGAGCAGTACGTCGGCCACCTG
GAGCTGCCGCGCGAGGACATGGTGGTCATGGTGACGTACGCCCGCATCCTGCTGATCCGGTCGCGGCGCCTGACG
AGCGAGTGGGACGTGAAGCTCAAGGACGTGCAGACGGTGGCCAAGGAGCGGACGGGGGTCAGCCTGACGCTGCGG
GGGGGGACCAACGGGCCGTTTATCCCGGTCGGGGGCGGCAGCGAGCGCGCGTATCTGTACCGCATGATTGGCGTG
GCGGCCGAGGAGTTTAACCGCCGCTTCCGGGGCGCCGAG
Transcript >Ophio5|4142
ATGCTGGAGGGGCTCGCTGCCGGCCTGCTCAATCGCTTCCTGGGCATGTACGTCCAGAACTTCGATCCCACCCAG
CTCAAGGTCGGCATCTGGTCTGGAGATGTGAAGTTACGCAACCTCGAGCTCCGGCGCGAGGCCCTTGACCAGCTC
AAGCTGCCCATCAACGTCGTCGAGGGCCATCTCGGCGAGCTGACGCTCGTCATCCCGTGGTCCAACCTGCGCGGC
GCCCCGGTCAAGGTATTCGTCGAGGACGTCTTTCTGCTTGCCAGCCCCAAGGAAGAGGCCGAATATGACCAGCAG
GAAGAGGAGCAGCGAAGCCAGCGGCTCAAGATGGAGAAACTCGACAGCGCCGAGCTGCTCAAGGAACGGAATCGA
GAGGGCATGAGTCCCGAGGAGCAGCAGAAGAACCAGAGCTTTACGCAGAGCCTCGTCACCAAGATTGTCGATAAC
CTGCAAATCACCGTCAAGAACATCCATGTCCGATACGAAGACTCCATTTCCGCCCCCGGCCATCCCTTTGCCCTC
GGCCTTACGCTCGAGGAGTTCTCAGCCGTCAGCACCGACGGCGAGTGGAAGCCGACTTTTATACAAAACTCCACC
GCCGTCACCAACAAGTTGGCTACGCTCGGCGCCCTGGCCGTGTATTGGAACACCGACACAGAACTCATGGGCAGC
GGGCGCGAGGCTGCGCTACCGCCAGAAGAGGCCATGCCTCATCGCGACATGGTGGCCAAGTTTCGCACCCTCATC
AACACAACTGCCACCTCGGACCATCAGTTCATCCTGAAGCCCGTCAGTGGGCAGGCCAAGATTGAGCTCAACAAG
TCGGGCGACGTCGTGGCCCCCAAGTTCAAGGTCAACCTGCTATTCGAGGAAATCGGCCTCGTGCTCGACGACCAC
CAGTATCGCGATGCCCTGATGATGGCCGATCTGTTCCACTACTTCATCCGCCACCAGGAATACAGGGCGCTCAAG
CCCAAGGGCGTCCGACCTGACCAGGATCCCCGGGCTTGGTTTCAATTCGCAGGCAACGCCGTGCTCGGAAAGATC
CACGAGCGGAATCGCACATGGTCCTGGGACTTTTTCAAGGAGCGCCGTGACGATCGCATCCGATACATCGAACTC
TTCAAGAAGAAGAAAGCGCAGCAGCAACTGTCACCGGACGAGGAAGAGAGTCTCGTGGCTTTGGAGTGGAAGCTG
GACTACGAAGACTTGCGGTTCTGGCGCTCTCTGGCCCGGAATCAACTGAAGAAGGAAAACGCAGAGGCACTGAAA
AGACAGACCCAGCAACTTGAGCACCAGGGCTGGATGTCGTGGATCTGGGGCTCGAAGCCCCAGGGAAAGATTGAG
AAGAACGAAGAAAACACTCAGATGACCGAGGAGCAGCGCAAGGAGCTGTACGACATGATCGACTGGGATGAAAAG
ACGGCTCTGGCGGAGACCATCGACGTTCCGCGCGAGGCCGTCAAGCTGTGCATCGAGGCTTCCCTCGGCACCGGG
AGCTTCACCCTCAGGCAGAGCAGTCACGGAAAGGCAGCAAGAGATCTTTTGGGCTTGTACTTTGACGTCTTCAAA
GCCAAGGCCCTGCAGCGCAAGGACTCTTTGCTCGCCAACATTAGTCTCGGGGGACTGCGAGTCGAGGACGGCACA
ACGCCAGACAGTCTGTATCCTGAGATTGTGCGAGTCAAGGACGCCCCCGAGACGGAGCCGCGCAAGAGGCTGTCC
TTGCTGGAGCTGGAGAGGAGCAGTGACGAGCCCTTCTTTCAGTTCGAGGTGGAGCAGAACCCGATCGAGCGCGAG
GGCGACGTTGCAGTCATCGGCAAGCTGAAGCCCCTCGAAATCGTCTGGAACCCCAATTTCGTCGTCGGCATCGTC
GACTTCTTCAGACCGCCCGAGAGGCACATGGAGTCCATCACGGCCCTCATGGAGAGCGCTGGCGCTACCGTCGAG
GGAATCAGAGAGCAGACGCGCGCAGGGCTCGAGTTTGCCCTCGAGGAACACAAGACGATCAATGCCGAGCTGGAC
CTACAGGCGCCCCTCATCATGGTCCCTTTCAGCATTACCACCAGAGAATCCACCTGCGTCATTGTCGACGCCGGC
CATATCCACGTCAACAGCCAGCTGGTGGACAAGGGCACCATGAAGGAGATACAGTCCAAGCAGCGGCAGACGTAC
AGCGAGGAGGACTTTAAGCGGCTGGAATCGGTCATGTACGACAAATTCATCGTCAAGCTCACCTCCACCCAGGTC
CTCATCGGGCCCTCCATCGAGGAGACCAAGGCGCAGCTGATGGGGAGAACGGAGGGCTCTCAGCTGCACGTGGTC
GAGAGGATCAACGTTGACTTTGTCGTGGAGACGTCGATTCTGCCCAAGGCCCCCAACCTGACCAAGTTCAGGGTG
TCTGGCCACCTGCCGATGCTTCATGCCTCGGTGTCGGACTCCAAGTACAAGAACCTGATGAAAATCATCGACGTG
GCGATCCCTAAACTCGGAGGGAGCGAGCAGAATGAGGCCCCCAAGCCTGGGGAGGGCGGGCAGCCCCCAGTGCCG
ACACCGCAGGAGCAGGCGAGGGAACCCGCGAGACCCCGGCTTGCTAGCAACAGCTCGAGTAGGTCTCGGCGGAGG
TCGCAGTGGGAGCGTCGGCAGTCGGCTGGCTTCCCCTTTCTGCAGCCGCCAAGCGCTGTTGTGCTCGACGACATG
GACGATGACCAAGACGACTTCGAGGACGCCTCAGACGGCGCAGACGGGGAGCAGCTCAAGATCCAGCAGCGGAGC
TTCGAGTTCAACTTCAAAGTCGACACCCTCAAGGGCTCGCTCTACCGCAGCGACCCGGACCGCGTGAAGCCTGAC
GCCCTACTGGTCGAGCTGGTGGCCGAGCGCTTCGACCTCGCCTTCTACACGAGGCTCTACGACATGTCTGCCGAG
GTGTCTCTCGGCGCCGTGTCCGTGGATGACTTTGTCGACAACCCCCCTGCCGAATTCAAGTCTATCGTCTCGTCC
GGCGACAGCGACGATCTCCAGGAGGGACGGAGTCTTGTCCACGTCAAGTACATGGATGTCAAGCGACAGTCGCCC
GAGTTTATGCCCGTGTACGAGGGAGTCAAGACAAACATTAGTGCCTCCGTATCGACCATCAACCTCGTCGTAACG
AGGAAGACGCTCCTGACGCTCCTCGACTTCATCCTCGTCACCTTTGCCGGAGGTAACAACGACCAGGAGCAGAGC
CGACCGGCCATCACCGACTCGGACGGCGATCACGACGAGGTGGCCGTGGAATCGGCGAAGCAGAATGCAGACTCG
GGTTCCATCAGGGTCAAGGTGGACTTGAAAGGGATCAGGCTCATTCTCAACAACGACGGCATAAGGCTGGCGACG
CTGTCGCTCACCGAGGCCGACGCCGGCATATTCCTCCGGGGAAAGACGATGCGAATATCGGCAAAGTTGGGAGAT
TTGTCCCTCGTCGACGACGTCAATCTGGGTGTATCCAGAGAATCCAACCTACGGAAGCTCGTCACCATCCAGGGC
GACGACCTCGCCGATTTCCGCTATGAGACGTTTGACCCGGATAACGAGCAGGCGTATCCAGGTTACGACAGTGCC
GTCTATCTGCGTGCCGGGTCGGTCAAGGTGAACTTTGTCGAGGAGCCGTTCCGCAAAATCATCGACTTCGTTGTC
AAGTTTGGCAGGATGCAAGCCCTGTACAACGCCGCGCGACAGGCTGCCGTCACACGCGCCAACCAGATGCAGCAG
AGTCCGAGCAGGTTCAAGTTCGACGTCGTCGTGAAGACGCCTATTGTCGTCTTTCCGCGCTTGATGGTGTCCGGC
TCGCCCGCGCGGGACCTTTTGACGGCATATTTGGGTGAGATCTATGTGCAGAATGAGTTTGCGCCGCTGGACGAG
GAAAATGATTGTCGAATCGCTATGAAGATATCGATGGGTATAAGGAAGATTCGACTCACGTCCGACTTTTACTAC
GAGGACGGTAGATCGGAAGAGCTGGAGATGATCGACCAAGTCGACCTCGGACTCAGCATCACCTACGCCGAGCAT
AAGCCTGGCGTTTTGCGTCCAGACACGGAAATCGAAGCCTCAATGTCAGACATCAAGCTCAGACTCACGCAGCAC
CAGCTCAAGTTCCTCATGGAGATTTCCAAAGCAGTTCCCGCTGCGTTCGCCGGTGATGACAGCGGCGGCGACGAG
GAAGCTAGCCAGCTTGTCGGCGAGGAAACACTGCGACGCGCAAGAACCGCGTCGGCAGACAATGGTTCCGGCCCC
GACCAGCGCGCCGTGGATCTCGGCCCCGAGTTGAAGTCGCCTACGGATACGTGGACGCAGTTGGACTTGGTCTTC
CGGGTCAATACCATCGGTCTCGAACTCGTCATGGCTCCGCAGGACGGGCCCGTGGGCGACTTGGCCGCCTCCAGC
CTATCGCGCTTCTCGCTCGACGAAACCAAAGTCAAGACTCGGATGATGTCTGATGGCTCGCTCGAAGCCGAGCTA
CTCATTCGCTCCTTTACCATCTACGACAGCCGTCCAAAGGGGGTAAACAAGTTCCGCCGCATCATGAGCTCATCC
AACAAGGAGTCCCAGCAGCTCATGGCCAGCGTCACCATGGCTGGCGGTAAAGAGCGCAACATGATTGCCATGGCG
ACCATCGACAGTCCTCGCGTCATCTTTGCGCTCGACTACCTCTTCGCTATTCAGACCTTTGCCACCGAGGGCCTG
ACAGTGGACGATTCCGGCCCGCTGGACGATGAAAGCACCGACGAGACGCCGGACGGCTCGGAATCGGCCGATTCC
TTGAGGGTCTCGTCCACCAAGGCCGGGCGCTCCAGGTCGCAGGCGACGTCTCTGCGGCGCAGCGAGTCGGGCTCG
GGCCAGTTGCAGAAGGGAGAGGCCTCGATGAGTTTAGCATTACGGATCAACCTCGTTGACGCGCAGGTCATACTC
ATTGCCAACCCGCTGAGGTCGAATTCTGAAGCTATCGTCCTGGGCATTCGGCAGGTGCTTCTCTCTCAGCAGAAC
GCGCTCACGTTCCAAGTCTCGGAAATGGGCATGTTTCTATGTGTAATGGACAGGTTCGAGACGTCGCGCCTCAGG
ATCATCGACGACTTTTCGATTCAGTTGAACATGGACACGTCACGGCCATCTCTGACAAGCTATCGCGTCGACGTC
GAGCCCCTCATCATCCGGCTGTCCCTGCGAGACATCCTCCTCGTGCTCCAGATCATCACCAAAGCTGGGGAGCTC
TCAGGCAATGGGAAGGAGCCCGCAAAGGAGACGCCGGCGGAGCAAAAGTCGAAGCAGCTGAGGGGCGCCGGCAAC
AAGACAAGAGCCCCCAGCGCCCGCGCTCAGTCAACCGTGGCAAAGACGAAAGCGAACCAGGCCGTTGTCGCCAAA
GGAGGAGCTTCTTCGACGACGACGACGGGTCAATCCGCCGCTCCGAGGCATGAGGATCTTTATGCTACGCTGCAA
GGTATGCGCATCGTACTGATCGGAGACCTGCACGAGCTGCCCATTCTCGATGTAGGAGTCAAGGAGTTCACGGCG
ACGGCGGAGAATTGGTCGTCGAATCTGAAAGCCGAGGCGGCCATACACACGTACACAAACGTCTACAACTTTTCG
AAATCCAGCTGGGAGCCTTTGATCGAGCCATGGCAGGTCGGCCTCGGCGTGGCAAGGGAGTCGGCGTCGGGCATA
CTGTCAGTCGACGTGGCGTCGAAGAAGACGCTCGACATCACCATCACGACGGCGACGATTGCGCTGGCCTCCAAG
TCGCTCGACTTTCTGACGACGCAGGAAAACGTGTTGGATAACCCGCGTTGGAGCGACGCGCCGTACCGCATCAAG
AATTACACGGGCTTCGCCGTCGTGATGCACTCGCGGAGCCCCAGCAGCGAGGAGCCCATCGATCTGCGACTCGAA
GACGGGGAGGAGGCGCCGTGGACGTTTGAAGACTGGGAGAAGATGCGTGAGAACCTGCTGACGGAAGCCGTGCAA
AACGACGTGGGCATCAGGCTGGAGGGCAGTGGTTTCGACACGGTCAAGAACGTACGGGTGAACCGAGAGGGCGAG
TTTCTCTACACTCTGCGGCCCAAGACGGACAACGTGACGCATCGGCTATGCGTGGACGTGCGTGTCGGGTCTGAC
AACGTCAAGGATGTCACGCTTCGGTCCCCGCTACTTGTCGAGAACGCGACGCAGATCCCCGTCGAGCTCGGCATC
TACGACGTCCAGGAAGGCCACCTCCTCAAGATTGAGAAGATTGCGCCGGGGGAAGCGAGGCCGGCTCCGGTGGGC
GCCGTGTACGAGAAGAGGGTCATTGTCCGTCCAGACAGCGGCTTCGGCTACCAATGGAGCAGAGACCAGCTCTGG
TGGAGAGATCTGCTCAAACGGCCGACCAAGCAGCTCGTCTGCAAGGGGGAGACGGGCGAATCCTTTTACTTTCAG
GCCCACGCCGACTTTGACAAGACCAACCCGTTATCCAAGACGTACCCCTCGATGACGATCAAACTCTCGGCACCA
GTCACTCTCGAAAATCTCTTGCCGTACGACTTCAAGTACAGGATCTACGACAGGAATACCAAGAGGGACTGGTCC
AACTTCCTACGCAAGGGTGGCGTGAGCCCCGTCCACATGGTGGAGCTCTCTCACCTCCTACTCCTGAGCGTCGAT
ATGCAGGACACCATGTTCAAGCCGAGTGACTTCTCCATCATCAATCCCGGGAATAATGACGACTTTCGGAAGGAG
AACCGGCTCGTGGTCAAGGACGAGCAAGGGCTGACACTGCATCTGAGCCTGCAATACTTCAAGGTGCCCAAGAGC
GGAGGCGCGTTCAAGATCAGCGTGTACAGCCCCTATGTCGTGTTGAACAAGACGGGACTCGACATGCGGATCCGC
GCCAAGAGCTTCCTACAGCAGTCCAAGGCGGCGGCCGGTCAATTTCCCGTGGTACAGACGGCCAGCCAAGACCGG
CCCAAGGCGCTGCCGTTGATGTTCTCGTTTGGAAACGACGAACATCAGAACCGGGCGCTGCTCAAGGTGGACGAG
TCGGAATGGAGCAAGCCACAGAGTTTCGACGCGGTGGGGAGCACGTCGGAGGTGGTGCTAAACTCGACTTCGAAG
CAGAGGGAGATTCATCTGGGCATGACGGTGCAATCGGGCGACGGCAAGTACAAGATGACCAAGGTGGTGACGCTG
GCGCCGCGGTTCGTGCTGGTCAACAAGCTGGGCGAGGAGATTTTGGTGCGGGAGTCGAGCTCGTCAGACTACATG
ACGGTCAAGGCCGGGGTGTTGCATCCGCTGCACTTTATGCAGAAGTCGGCGGTGAAGCAGCTGTGCCTACGCTTC
CCGGGCGTCGACGACCACTGGACTTCGCCCTTCAACATCGCCGACGTGGGGACGACGCACGTCAAGATGGCCAAG
GCCGGGCAGCGGCAGCGGCTGGTGAGGGTCGAGATCCTTACCGAGGAGTCGACCATCTTCCTGCACATGAGCATC
GAGGACAAGCATTGGCCCTTTTCGATGCGCAACGAGAGCGACACCGAGTTCTCCTTTTACCAGGCCAACCCCAAC
GTGGAAGGGGACGACGACGAGGACCGGAGCGGATGGAAGCCCGTGCGGTACCGGCTGCCGCCGCGGAGCGTGATG
CCGTACGCGTGGGACTTTCCGGCGGCCAAGTTCCGCGAGGTCATCATCTCGGCCAACGGCAAGGAGCGGCACGTC
AAGCTGGCCGAGATGGGCAACCAGATCCCGATGAAGTTCGTCGGAGCGGGAGGGGAGCACAAGATCATCGACATC
AACGTGGCGGCCGACGGACCGACGCAGACGCTGATCCTCAGCAACTTCCGGGCGAGCAAGAGCATGTTCAAGCCG
GCGGCGCTGTCGCGGACCAAGACGGGGCCCGAGGCGTTCGAGGTCAAGGACCAGGGCACGGGGGCGACGCTGTTG
GCGCAGCTGAAGCTGTCGGGCATCGGCGTCTCGCTCATCAACGCGCAGCTCAAGGAGCTGGCATACGTGACGCTG
CGCGAGGTGCAGCTGCGGTTCAGCGACTCGCCCCTGATCCAGACCATGTCGCTGGCGGTCAAGTGGATCCAGATC
GACAACCAGCTGTACGGCGGCATCTTCCCCATCATCCTCTACCCGAGCGTGGTGCCGAAGCGGGCCAACGAGGTG
GAGGCGCACCCGTCGCTGCACGCCATGGTCAGCCGGGTCAAGGACGACTCGTACGGGGTGGTGTACATCAAGTAC
GCGACGATGCTGCTGCAGCAGATGACGGTGGACCTGGACGAGGACTTTGTCTTTGCCCTGCTCGACTTCTCCAAC
ATCCCCGGCGCGAGCTGGGCGGCGGCCGAGCCGGCGTCGGGCCGGCTGTGCGACGAGGACATTGGCATCCCCGAG
CCGTCGCGGCAGCAGTCCGGGCAGGACATGTACTTTGAGGTGCTCAACATTCAGCCGATGCAGCTGGACCTCAGC
TTCGTCCGGACGGAGCGGGTCAACGCCGAGGACAAGACGTCGACGCGGAACCCCATCATGTTCTTCCTCAACGTC
ATGACCATGGCCATTGGCAACGTCAACGACGCGCCGATCCGGTTCAACGCGCTGATGCTGGACAACGTGAGGGTG
TCGCGGGCGGTGCTGGTGCAGAACATGTCGAGCCACTACAGCCAGGAGGTCATGTACCAGATCCACAAGATCCTC
GGCTCGGCCGACTTCCTCGGCAACCCGGTCGGGCTGTTCAACAACATCTCGTCGGGCGTGACGGACATCTTTTAC
GAGCCCTACCAGGGGCTCATACTGTCGGACCGGCCCGAGGAGTTTGGCATCGGCATCGCGCGCGGGGCCGTGTCG
TTTGCCAAGAAGACGGTCTACGGCTTCAGCGACAGCTTCTCCAAGTTCACGGGCAGCCTGGGCAAGGGCCTGGCG
GCGGCCTCGCTCGACAAGCAGTTCCAGGACCGGCGGCGCATCACCAAGGCGCGCAACCGGCCCAAGCACGCGCTG
TACGGGGTGGCGGCGGGCGCCAACTCGCTGCTGACGAGCGTGGCGTCGGGCGTGGGCGGGCTGGCGCGCAAGCCG
CTGGAGGGGGCCGAGCAGGAGGGCGCCCTGGGCTTCTTCAAGGGCGTGGGCAAGGGCGTGCTCGGGCTGGCGACG
AAGCCGGCGGTGGGGGTGCTGGACATGGCGAGCAACGTCAGCGAGGGCATCCGCAACACGACGACGGTCTTTGAC
GGGTCGGAGCTGGACCGGACGCGGCTGCCGCGCTTCATGGCCAACGACGGCATCGTCAGGCCGTACGGGGCGCGG
GAGGCGCTGGGCCAGTTCTGGCTGAAGCAGGTCGACAACGGCAAGTACTTTGACGAGCAGTACGTCGGCCACCTG
GAGCTGCCGCGCGAGGACATGGTGGTCATGGTGACGTACGCCCGCATCCTGCTGATCCGGTCGCGGCGCCTGACG
AGCGAGTGGGACGTGAAGCTCAAGGACGTGCAGACGGTGGCCAAGGAGCGGACGGGGGTCAGCCTGACGCTGCGG
GGGGGGACCAACGGGCCGTTTATCCCGGTCGGGGGCGGCAGCGAGCGCGCGTATCTGTACCGCATGATTGGCGTG
GCGGCCGAGGAGTTTAACCGCCGCTTCCGGGGCGCCGAGTGA
Gene >Ophio5|4142
ATGCTGGAGGGGCTCGCTGCCGGCCTGCTCAATCGCTTCCTGGGCATGTACGTCCAGAACTTCGATCCCACCCAG
CTCAAGGTCGGCATCTGGTCTGGAGATGTGAAGTTACGCAACCTCGAGCTCCGGCGCGAGGCCCTTGACCAGCTC
AAGCTGCCCATCAACGTCGTCGAGGGCCATCTCGGCGAGCTGACGCTCGTCATCCCGTGGTCCAACCTGCGCGGC
GCCCCGGTCAAGGTATTCGTCGAGGACGTCTTTCTGCTTGCCAGCCCCAAGGAAGAGGCCGAATATGACCAGCAG
GAAGAGGAGCAGCGAAGCCAGCGGCTCAAGATGGAGAAACTCGACAGCGCCGAGCTGCTCAAGGAACGGAATCGA
GAGGGCATGAGTCCCGAGGAGCAGCAGAAGAACCAGAGCTTTACGCAGAGCCTCGTCACCAAGATTGTCGATAAC
CTGCAAATCACCGTCAAGAACATCCATGTCCGATACGAAGACTCCATTTCCGCCCCCGGCCATCCCTTTGCCCTC
GGCCTTACGCTCGAGGAGTTCTCAGCCGTCAGCACCGACGGCGAGTGGAAGCCGACTTTTATACAAAACTCCACC
GCCGTCACCAACAAGTTGGCTACGCTCGGCGCCCTGGCCGTGTATTGGAACACCGACACAGAACTCATGGGCAGC
GGGCGCGAGGCTGCGCTACCGCCAGAAGAGGCCATGCCTCATCGCGACATGGTGGCCAAGTTTCGCACCCTCATC
AACACAACTGCCACCTCGGACCATCAGTTCATCCTGAAGCCCGTCAGTGGGCAGGCCAAGATTGAGCTCAACAAG
TCGGGCGACGTCGTGGCCCCCAAGTTCAAGGTCAACCTGCTATTCGAGGAAATCGGCCTCGTGCTCGACGACCAC
CAGTATCGCGATGCCCTGATGATGGCCGATCTGTTCCACTACTTCATCCGCCACCAGGAATACAGGGCGCTCAAG
CCCAAGGGCGTCCGACCTGACCAGGATCCCCGGGCTTGGTTTCAATTCGCAGGCAACGCCGTGCTCGGAAAGATC
CACGAGCGGAATCGCACATGGTCCTGGGACTTTTTCAAGGAGCGCCGTGACGATCGCATCCGATACATCGAACTC
TTCAAGAAGAAGAAAGCGCAGCAGCAACTGTCACCGGACGAGGAAGAGAGTCTCGTGGCTTTGGAGTGGAAGCTG
GACTACGAAGACTTGCGGTTCTGGCGCTCTCTGGCCCGGAATCAACTGAAGAAGGAAAACGCAGAGGCACTGAAA
AGACAGACCCAGCAACTTGAGCACCAGGGCTGGATGTCGTGGATCTGGGGCTCGAAGCCCCAGGGAAAGATTGAG
AAGAACGAAGAAAACACTCAGATGACCGAGGAGCAGCGCAAGGAGCTGTACGACATGATCGACTGGGATGAAAAG
ACGGCTCTGGCGGAGACCATCGACGTTCCGCGCGAGGCCGTCAAGCTGTGCATCGAGGCTTCCCTCGGCACCGGG
AGCTTCACCCTCAGGCAGAGCAGTCACGGAAAGGCAGCAAGAGATCTTTTGGGCTTGTACTTTGACGTCTTCAAA
GCCAAGGCCCTGCAGCGCAAGGACTCTTTGCTCGCCAACATTAGTCTCGGGGGACTGCGAGTCGAGGACGGCACA
ACGCCAGACAGTCTGTATCCTGAGATTGTGCGAGTCAAGGACGCCCCCGAGACGGAGCCGCGCAAGAGGCTGTCC
TTGCTGGAGCTGGAGAGGAGCAGTGACGAGCCCTTCTTTCAGTTCGAGGTGGAGCAGAACCCGATCGAGCGCGAG
GGCGACGTTGCAGTCATCGGCAAGCTGAAGCCCCTCGAAATCGTCTGGAACCCCAATTTCGTCGTCGGCATCGTC
GACTTCTTCAGACCGCCCGAGAGGCACATGGAGTCCATCACGGCCCTCATGGAGAGCGCTGGCGCTACCGTCGAG
GGAATCAGAGAGCAGACGCGCGCAGGGCTCGAGTTTGCCCTCGAGGAACACAAGACGATCAATGCCGAGCTGGAC
CTACAGGCGCCCCTCATCATGGTCCCTTTCAGCATTACCACCAGAGAATCCACCTGCGTCATTGTCGACGCCGGC
CATATCCACGTCAACAGCCAGCTGGTGGACAAGGGCACCATGAAGGAGATACAGTCCAAGCAGCGGCAGACGTAC
AGCGAGGAGGACTTTAAGCGGCTGGAATCGGTCATGTACGACAAATTCATCGTCAAGCTCACCTCCACCCAGGTC
CTCATCGGGCCCTCCATCGAGGAGACCAAGGCGCAGCTGATGGGGAGAACGGAGGGCTCTCAGCTGCACGTGGTC
GAGAGGATCAACGTTGACTTTGTCGTGGAGACGTCGATTCTGCCCAAGGCCCCCAACCTGACCAAGTTCAGGGTG
TCTGGCCACCTGCCGATGCTTCATGCCTCGGTGTCGGACTCCAAGTACAAGAACCTGATGAAAATCATCGACGTG
GCGATCCCTAAACTCGGAGGGAGCGAGCAGAATGAGGCCCCCAAGCCTGGGGAGGGCGGGCAGCCCCCAGTGCCG
ACACCGCAGGAGCAGGCGAGGGAACCCGCGAGACCCCGGCTTGCTAGCAACAGCTCGAGTAGGTCTCGGCGGAGG
TCGCAGTGGGAGCGTCGGCAGTCGGCTGGCTTCCCCTTTCTGCAGCCGCCAAGCGCTGTTGTGCTCGACGACATG
GACGATGACCAAGACGACTTCGAGGACGCCTCAGACGGCGCAGACGGGGAGCAGCTCAAGATCCAGCAGCGGAGC
TTCGAGTTCAACTTCAAAGTCGACACCCTCAAGGGCTCGCTCTACCGCAGCGACCCGGACCGCGTGAAGCCTGAC
GCCCTACTGGTCGAGCTGGTGGCCGAGCGCTTCGACCTCGCCTTCTACACGAGGCTCTACGACATGTCTGCCGAG
GTGTCTCTCGGCGCCGTGTCCGTGGATGACTTTGTCGACAACCCCCCTGCCGAATTCAAGTCTATCGTCTCGTCC
GGCGACAGCGACGATCTCCAGGAGGGACGGAGTCTTGTCCACGTCAAGTACATGGATGTCAAGCGACAGTCGCCC
GAGTTTATGCCCGTGTACGAGGGAGTCAAGACAAACATTAGTGCCTCCGTATCGACCATCAACCTCGTCGTAACG
AGGAAGACGCTCCTGACGCTCCTCGACTTCATCCTCGTCACCTTTGCCGGAGGTAACAACGACCAGGAGCAGAGC
CGACCGGCCATCACCGACTCGGACGGCGATCACGACGAGGTGGCCGTGGAATCGGCGAAGCAGAATGCAGACTCG
GGTTCCATCAGGGTCAAGGTGGACTTGAAAGGGATCAGGCTCATTCTCAACAACGACGGCATAAGGCTGGCGACG
CTGTCGCTCACCGAGGCCGACGCCGGCATATTCCTCCGGGGAAAGACGATGCGAATATCGGCAAAGTTGGGAGAT
TTGTCCCTCGTCGACGACGTCAATCTGGGTGTATCCAGAGAATCCAACCTACGGAAGCTCGTCACCATCCAGGGC
GACGACCTCGCCGATTTCCGCTATGAGACGTTTGACCCGGATAACGAGCAGGCGTATCCAGGTTACGACAGTGCC
GTCTATCTGCGTGCCGGGTCGGTCAAGGTGAACTTTGTCGAGGAGCCGTTCCGCAAAATCATCGACTTCGTTGTC
AAGTTTGGCAGGATGCAAGCCCTGTACAACGCCGCGCGACAGGCTGCCGTCACACGCGCCAACCAGATGCAGCAG
AGTCCGAGCAGGTTCAAGTTCGACGTCGTCGTGAAGACGCCTATTGTCGTCTTTCCGCGCTTGATGGTGTCCGGC
TCGCCCGCGCGGGACCTTTTGACGGCATATTTGGGTGAGATCTATGTGCAGAATGAGTTTGCGCCGCTGGACGAG
GAAAATGATTGTCGAATCGCTATGAAGATATCGATGGGTATAAGGAAGATTCGACTCACGTCCGACTTTTACTAC
GAGGACGGTAGATCGGAAGAGCTGGAGATGATCGACCAAGTCGACCTCGGACTCAGCATCACCTACGCCGAGCAT
AAGCCTGGCGTTTTGCGTCCAGACACGGAAATCGAAGCCTCAATGTCAGACATCAAGCTCAGACTCACGCAGCAC
CAGCTCAAGTTCCTCATGGAGATTTCCAAAGCAGTTCCCGCTGCGTTCGCCGGTGATGACAGCGGCGGCGACGAG
GAAGCTAGCCAGCTTGTCGGCGAGGAAACACTGCGACGCGCAAGAACCGCGTCGGCAGACAATGGTTCCGGCCCC
GACCAGCGCGCCGTGGATCTCGGCCCCGAGTTGAAGTCGCCTACGGATACGTGGACGCAGTTGGACTTGGTCTTC
CGGGTCAATACCATCGGTCTCGAACTCGTCATGGCTCCGCAGGACGGGCCCGTGGGCGACTTGGCCGCCTCCAGC
CTATCGCGCTTCTCGCTCGACGAAACCAAAGTCAAGACTCGGATGATGTCTGATGGCTCGCTCGAAGCCGAGCTA
CTCATTCGCTCCTTTACCATCTACGACAGCCGTCCAAAGGGGGTAAACAAGTTCCGCCGCATCATGAGCTCATCC
AACAAGGAGTCCCAGCAGCTCATGGCCAGCGTCACCATGGCTGGCGGTAAAGAGCGCAACATGATTGCCATGGCG
ACCATCGACAGTCCTCGCGTCATCTTTGCGCTCGACTACCTCTTCGCTATTCAGACCTTTGCCACCGAGGGCCTG
ACAGTGGACGATTCCGGCCCGCTGGACGATGAAAGCACCGACGAGACGCCGGACGGCTCGGAATCGGCCGATTCC
TTGAGGGTCTCGTCCACCAAGGCCGGGCGCTCCAGGTCGCAGGCGACGTCTCTGCGGCGCAGCGAGTCGGGCTCG
GGCCAGTTGCAGAAGGGAGAGGCCTCGATGAGTTTAGCATTACGGATCAACCTCGTTGACGCGCAGGTCATACTC
ATTGCCAACCCGCTGAGGTCGAATTCTGAAGCTATCGTCCTGGGCATTCGGCAGGTGCTTCTCTCTCAGCAGAAC
GCGCTCACGTTCCAAGTCTCGGAAATGGGCATGTTTCTATGTGTAATGGACAGGTTCGAGACGTCGCGCCTCAGG
ATCATCGACGACTTTTCGATTCAGTTGAACATGGACACGTCACGGCCATCTCTGACAAGCTATCGCGTCGACGTC
GAGCCCCTCATCATCCGGCTGTCCCTGCGAGACATCCTCCTCGTGCTCCAGATCATCACCAAAGCTGGGGAGCTC
TCAGGCAATGGGAAGGAGCCCGCAAAGGAGACGCCGGCGGAGCAAAAGTCGAAGCAGCTGAGGGGCGCCGGCAAC
AAGACAAGAGCCCCCAGCGCCCGCGCTCAGTCAACCGTGGCAAAGACGAAAGCGAACCAGGCCGTTGTCGCCAAA
GGAGGAGCTTCTTCGACGACGACGACGGGTCAATCCGCCGCTCCGAGGCATGAGGATCTTTATGCTACGCTGCAA
GGTATGCGCATCGTACTGATCGGAGACCTGCACGAGCTGCCCATTCTCGATGTAGGAGTCAAGGAGTTCACGGCG
ACGGCGGAGAATTGGTCGTCGAATCTGAAAGCCGAGGCGGCCATACACACGTACACAAACGTCTACAACTTTTCG
AAATCCAGCTGGGAGCCTTTGATCGAGCCATGGCAGGTCGGCCTCGGCGTGGCAAGGGAGTCGGCGTCGGGCATA
CTGTCAGTCGACGTGGCGTCGAAGAAGACGCTCGACATCACCATCACGACGGCGACGATTGCGCTGGCCTCCAAG
TCGCTCGACTTTCTGACGACGCAGGAAAACGTGTTGGATAACCCGCGTTGGAGCGACGCGCCGTACCGCATCAAG
AATTACACGGGCTTCGCCGTCGTGATGCACTCGCGGAGCCCCAGCAGCGAGGAGCCCATCGATCTGCGACTCGAA
GACGGGGAGGAGGCGCCGTGGACGTTTGAAGACTGGGAGAAGATGCGTGAGAACCTGCTGACGGAAGCCGTGCAA
AACGACGTGGGCATCAGGCTGGAGGGCAGTGGTTTCGACACGGTCAAGAACGTACGGGTGAACCGAGAGGGCGAG
TTTCTCTACACTCTGCGGCCCAAGACGGACAACGTGACGCATCGGCTATGCGTGGACGTGCGTGTCGGGTCTGAC
AACGTCAAGGATGTCACGCTTCGGTCCCCGCTACTTGTCGAGAACGCGACGCAGATCCCCGTCGAGCTCGGCATC
TACGACGTCCAGGAAGGCCACCTCCTCAAGATTGAGAAGATTGCGCCGGGGGAAGCGAGGCCGGCTCCGGTGGGC
GCCGTGTACGAGAAGAGGGTCATTGTCCGTCCAGACAGCGGCTTCGGCTACCAATGGAGCAGAGACCAGCTCTGG
TGGAGAGATCTGCTCAAACGGCCGACCAAGCAGCTCGTCTGCAAGGGGGAGACGGGCGAATCCTTTTACTTTCAG
GCCCACGCCGACTTTGACAAGACCAACCCGTTATCCAAGTAAGTATTGGCCCCCTCCCCGGGCGTGGCCTTGGTC
CTCCCACAGCAGCGTTGACGGAGTGATGAAAAAGGACGTACCCCTCGATGACGATCAAACTCTCGGCACCAGTCA
CTCTCGAAAATCTCTTGCCGTACGACTTCAAGTACAGGATCTACGACAGGAATACCAAGAGGGACTGGTCCAACT
TCCTACGCAAGGGTGGCGTGAGCCCCGTCCACATGGTGGAGCTCTCTCACCTCCTACTCCTGAGCGTCGATATGC
AGGACACCATGTTCAAGCCGAGTGACTTCTCCATCATCAATCCCGGGAATAATGACGACTTTCGGAAGGAGAACC
GGCTCGTGGTCAAGGACGAGCAAGGGCTGACACTGCATCTGAGCCTGCAATACTTCAAGGTGCCCAAGAGCGGAG
GCGCGTTCAAGATCAGCGTGTACAGCCCCTATGTCGTGTTGAACAAGACGGGACTCGACATGCGGATCCGCGCCA
AGAGCTTCCTACAGCAGTCCAAGGCGGCGGCCGGTCAATTTCCCGTGGTACAGACGGCCAGCCAAGACCGGCCCA
AGGCGCTGCCGTTGATGTTCTCGTTTGGAAACGACGAACATCAGAACCGGGCGCTGCTCAAGGTGGACGAGTCGG
AATGGAGCAAGCCACAGAGTTTCGACGCGGTGGGGAGCACGTCGGAGGTGGTGCTAAACTCGACTTCGAAGCAGA
GGGAGATTCATCTGGGCATGACGGTGCAATCGGGCGACGGCAAGTACAAGATGACCAAGGTGGTGACGCTGGCGC
CGCGGTTCGTGCTGGTCAACAAGCTGGGCGAGGAGATTTTGGTGCGGGAGTCGAGCTCGTCAGACTACATGACGG
TCAAGGCCGGGGTGTTGCATCCGCTGCACTTTATGCAGAAGTCGGCGGTGAAGCAGCTGTGCCTACGCTTCCCGG
GCGTCGACGACCACTGGACTTCGCCCTTCAACATCGCCGACGTGGGGACGACGCACGTCAAGATGGCCAAGGCCG
GGCAGCGGCAGCGGCTGGTGAGGGTCGAGATCCTTACCGAGGAGTCGACCATCTTCCTGCACATGAGCATCGAGG
ACAAGCATTGGCCCTTTTCGATGCGCAACGAGAGCGACACCGAGTTCTCCTTTTACCAGGCCAACCCCAACGTGG
AAGGGGACGACGACGAGGACCGGAGCGGATGGAAGCCCGTGCGGTACCGGCTGCCGCCGCGGAGCGTGATGCCGT
ACGCGTGGGACTTTCCGGCGGCCAAGTTCCGCGAGGTCATCATCTCGGCCAACGGCAAGGAGCGGCACGTCAAGC
TGGCCGAGATGGGCAACCAGATCCCGATGAAGTTCGTCGGAGCGGGAGGGGAGCACAAGATCATCGACATCAACG
TGGCGGCCGACGGACCGACGCAGACGCTGATCCTCAGCAACTTCCGGGCGAGCAAGAGCATGTTCAAGCCGGCGG
CGCTGTCGCGGACCAAGACGGGGCCCGAGGCGTTCGAGGTCAAGGACCAGGGCACGGGGGCGACGCTGTTGGCGC
AGCTGAAGCTGTCGGGCATCGGCGTCTCGCTCATCAACGCGCAGCTCAAGGAGCTGGCATACGTGACGCTGCGCG
AGGTGCAGCTGCGGTTCAGCGACTCGCCCCTGATCCAGACCATGTCGCTGGCGGTCAAGTGGATCCAGATCGACA
ACCAGCTGTACGGCGGCATCTTCCCCATCATCCTCTACCCGAGCGTGGTGCCGAAGCGGGCCAACGAGGTGGAGG
CGCACCCGTCGCTGCACGCCATGGTCAGCCGGGTCAAGGACGACTCGTACGGGGTGGTGTACATCAAGTACGCGA
CGATGCTGCTGCAGCAGATGACGGTGGACCTGGACGAGGACTTTGTCTTTGCCCTGCTCGACTTCTCCAACATCC
CCGGCGCGAGCTGGGCGGCGGCCGAGCCGGCGTCGGGCCGGCTGTGCGACGAGGACATTGGCATCCCCGAGCCGT
CGCGGCAGCAGTCCGGGCAGGACATGTACTTTGAGGTGCTCAACATTCAGCCGATGCAGCTGGACCTCAGCTTCG
TCCGGACGGAGCGGGTCAACGCCGAGGACAAGACGTCGACGCGGAACCCCATCATGTTCTTCCTCAACGTCATGA
CCATGGCCATTGGCAACGTCAACGACGCGCCGATCCGGTTCAACGCGCTGATGCTGGACAACGTGAGGGTGTCGC
GGGCGGTGCTGGTGCAGAACATGTCGAGCCACTACAGCCAGGAGGTCATGTACCAGATCCACAAGATCCTCGGCT
CGGCCGACTTCCTCGGCAACCCGGTCGGGCTGTTCAACAACATCTCGTCGGGCGTGACGGACATCTTTTACGAGC
CCTACCAGGGGCTCATACTGTCGGACCGGCCCGAGGAGTTTGGCATCGGCATCGCGCGCGGGGCCGTGTCGTTTG
CCAAGAAGACGGTCTACGGCTTCAGCGACAGCTTCTCCAAGTTCACGGGCAGCCTGGGCAAGGGCCTGGCGGCGG
CCTCGCTCGACAAGCAGTTCCAGGACCGGCGGCGCATCACCAAGGCGCGCAACCGGCCCAAGCACGCGCTGTACG
GGGTGGCGGCGGGCGCCAACTCGCTGCTGACGAGCGTGGCGTCGGGCGTGGGCGGGCTGGCGCGCAAGCCGCTGG
AGGGGGCCGAGCAGGAGGGCGCCCTGGGCTTCTTCAAGGGCGTGGGCAAGGGCGTGCTCGGGCTGGCGACGAAGC
CGGCGGTGGGGGTGCTGGACATGGCGAGCAACGTCAGCGAGGGCATCCGCAACACGACGACGGTCTTTGACGGGT
CGGAGCTGGACCGGACGCGGCTGCCGCGCTTCATGGCCAACGACGGCATCGTCAGGCCGTACGGGGCGCGGGAGG
CGCTGGGCCAGTTCTGGCTGAAGCAGGTCGACAACGGCAAGTACTTTGACGAGCAGTACGTCGGCCACCTGGAGC
TGCCGCGCGAGGACATGGTGGTCATGGTGACGTACGCCCGCATCCTGCTGATCCGGTCGCGGCGCCTGACGAGCG
AGTGGGACGTGAAGCTCAAGGACGTGCAGACGGTGGCCAAGGAGCGGACGGGGGTCAGCCTGACGCTGCGGGGGG
GGACCAACGGGCCGTTTATCCCGGTCGGGGGCGGCAGCGAGCGCGCGTATCTGTACCGCATGATTGGCGTGGCGG
CCGAGGAGTTTAACCGCCGCTTCCGGGGCGCCGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail