Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4141
Gene name
Locationscaffold_325:10444..12079
Strand-
Gene length (bp)1635
Transcript length (bp)1518
Coding sequence length (bp)1515
Protein length (aa) 505

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11911 DUF3429 Protein of unknown function (DUF3429) 1.1E-44 180 343

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.0635 0.097 0.0279 0.0845 0.9122 0.1167 0.0995 0.0481 0.1059 0.0297

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 240 262 22
2 275 297 22
3 326 345 19

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2094
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3933
Ophiocordyceps australis map64 (Brazil) OphauB2|7981
Ophiocordyceps camponoti-floridani Ophcf2|00645
Ophiocordyceps camponoti-rufipedis Ophun1|2026
Ophiocordyceps kimflemingae Ophio5|4141 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2461

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4141
MAAPQPPPPAPFFPSSSFSDLLTLPTYLYLPDILLPDATRSVCTRRRYDLEPTMLQHLRPSRPLLLRLVPSASAQ
PLSRSPASASLRWQPAAIWSLPRTRPLLRFASSDSKAPPPQRRGQQQPPTVDKREIRPDRVSEQSTVRPIFEKSP
PSAPDKNADLGRDLKHDIEAFRDTFRLDAVPRESRILGLAGTLPYVATSLSTLFLAWDLNRDPPTGNSMLDPVFI
NHDTARYLLDLIEPLQLGYGAVIISFLGAIHWGLEYAEKQPSLARTRFRYGIGVAASVVAWPTVLMPIEHALTAQ
FMAFAALYLVDSRASARGWAPSWYNTYRFLLTAIVGLAILVSLVGRANISVHGRLSSSGLRSSMNNPGIADHQTD
WAKLENEEKARIKKEEEKARKKKEKEEAKRKASGNKGKKSEKAERKGNAGGKETDDEESDKDEGESEEDEEDGRA
EDDGEDEDDGEDEDGKDANGDGKKKDDKSKDAKEEGKKKDDKGKDDQGDADAKPN
Coding >Ophio5|4141
ATGGCTGCCCCCCAACCCCCCCCCCCCGCGCCCTTCTTCCCCTCCTCTTCCTTTAGCGACCTCCTTACCTTGCCG
ACCTACCTCTACCTACCGGACATTCTCCTCCCCGACGCTACCCGCTCAGTCTGCACTCGGCGGCGATACGACCTC
GAGCCCACTATGTTACAACACCTACGTCCCTCACGGCCTCTTCTCCTCCGGCTCGTCCCTTCGGCCTCAGCCCAG
CCTTTGTCACGATCTCCAGCGTCTGCTTCTCTTCGATGGCAGCCCGCCGCGATCTGGTCGCTCCCGCGGACACGC
CCCCTGCTCCGATTCGCAAGCAGCGACTCCAAAGCTCCTCCTCCGCAAAGGCGCGGCCAGCAGCAGCCGCCGACA
GTCGACAAGCGCGAGATACGCCCCGACCGGGTCTCAGAGCAGAGTACGGTGCGGCCGATATTCGAAAAGTCTCCG
CCGTCTGCGCCCGACAAAAATGCAGATCTGGGCCGCGATCTGAAGCATGATATCGAAGCCTTTCGCGACACATTT
CGCCTCGATGCTGTCCCTCGAGAATCCCGCATCCTCGGCCTCGCCGGCACACTTCCCTATGTGGCAACCTCACTC
TCGACTCTATTCTTAGCCTGGGATCTGAATAGAGACCCGCCGACGGGCAATTCTATGCTTGACCCGGTCTTCATC
AACCACGACACTGCCCGGTATCTCCTCGACCTTATTGAGCCGCTGCAGCTTGGCTACGGAGCCGTCATTATTTCC
TTTCTCGGCGCAATTCACTGGGGACTCGAGTATGCCGAGAAGCAGCCGTCGCTCGCGCGCACCCGCTTCCGTTAC
GGTATCGGCGTCGCCGCCTCCGTCGTGGCCTGGCCTACCGTTCTCATGCCTATCGAGCACGCGCTCACCGCCCAA
TTCATGGCCTTTGCCGCCCTGTACTTGGTCGACTCGCGGGCGTCGGCGCGAGGATGGGCCCCCTCTTGGTACAAC
ACCTACCGCTTCCTGCTCACGGCCATTGTCGGCCTCGCCATCCTCGTGTCCCTGGTGGGGAGAGCAAACATTAGC
GTCCACGGCAGGCTCAGCTCTTCAGGCCTGAGATCCAGCATGAACAACCCGGGAATCGCCGATCACCAAACCGAC
TGGGCTAAGTTGGAGAACGAGGAGAAGGCCAGAATCAAAAAGGAGGAGGAGAAGGCCAGGAAGAAGAAGGAGAAG
GAAGAGGCTAAACGCAAGGCCAGTGGCAACAAGGGAAAGAAGTCCGAGAAGGCCGAGAGGAAGGGTAATGCGGGC
GGCAAAGAGACCGACGACGAAGAGAGCGACAAAGATGAGGGCGAGAGCGAGGAGGACGAGGAGGACGGAAGGGCC
GAGGATGACGGCGAGGACGAGGATGACGGTGAGGACGAGGACGGCAAGGACGCCAACGGGGACGGCAAGAAGAAA
GATGACAAGAGCAAGGACGCCAAAGAGGAAGGCAAAAAGAAAGACGACAAGGGCAAAGACGACCAAGGCGACGCC
GACGCAAAGCCCAAC
Transcript >Ophio5|4141
ATGGCTGCCCCCCAACCCCCCCCCCCCGCGCCCTTCTTCCCCTCCTCTTCCTTTAGCGACCTCCTTACCTTGCCG
ACCTACCTCTACCTACCGGACATTCTCCTCCCCGACGCTACCCGCTCAGTCTGCACTCGGCGGCGATACGACCTC
GAGCCCACTATGTTACAACACCTACGTCCCTCACGGCCTCTTCTCCTCCGGCTCGTCCCTTCGGCCTCAGCCCAG
CCTTTGTCACGATCTCCAGCGTCTGCTTCTCTTCGATGGCAGCCCGCCGCGATCTGGTCGCTCCCGCGGACACGC
CCCCTGCTCCGATTCGCAAGCAGCGACTCCAAAGCTCCTCCTCCGCAAAGGCGCGGCCAGCAGCAGCCGCCGACA
GTCGACAAGCGCGAGATACGCCCCGACCGGGTCTCAGAGCAGAGTACGGTGCGGCCGATATTCGAAAAGTCTCCG
CCGTCTGCGCCCGACAAAAATGCAGATCTGGGCCGCGATCTGAAGCATGATATCGAAGCCTTTCGCGACACATTT
CGCCTCGATGCTGTCCCTCGAGAATCCCGCATCCTCGGCCTCGCCGGCACACTTCCCTATGTGGCAACCTCACTC
TCGACTCTATTCTTAGCCTGGGATCTGAATAGAGACCCGCCGACGGGCAATTCTATGCTTGACCCGGTCTTCATC
AACCACGACACTGCCCGGTATCTCCTCGACCTTATTGAGCCGCTGCAGCTTGGCTACGGAGCCGTCATTATTTCC
TTTCTCGGCGCAATTCACTGGGGACTCGAGTATGCCGAGAAGCAGCCGTCGCTCGCGCGCACCCGCTTCCGTTAC
GGTATCGGCGTCGCCGCCTCCGTCGTGGCCTGGCCTACCGTTCTCATGCCTATCGAGCACGCGCTCACCGCCCAA
TTCATGGCCTTTGCCGCCCTGTACTTGGTCGACTCGCGGGCGTCGGCGCGAGGATGGGCCCCCTCTTGGTACAAC
ACCTACCGCTTCCTGCTCACGGCCATTGTCGGCCTCGCCATCCTCGTGTCCCTGGTGGGGAGAGCAAACATTAGC
GTCCACGGCAGGCTCAGCTCTTCAGGCCTGAGATCCAGCATGAACAACCCGGGAATCGCCGATCACCAAACCGAC
TGGGCTAAGTTGGAGAACGAGGAGAAGGCCAGAATCAAAAAGGAGGAGGAGAAGGCCAGGAAGAAGAAGGAGAAG
GAAGAGGCTAAACGCAAGGCCAGTGGCAACAAGGGAAAGAAGTCCGAGAAGGCCGAGAGGAAGGGTAATGCGGGC
GGCAAAGAGACCGACGACGAAGAGAGCGACAAAGATGAGGGCGAGAGCGAGGAGGACGAGGAGGACGGAAGGGCC
GAGGATGACGGCGAGGACGAGGATGACGGTGAGGACGAGGACGGCAAGGACGCCAACGGGGACGGCAAGAAGAAA
GATGACAAGAGCAAGGACGCCAAAGAGGAAGGCAAAAAGAAAGACGACAAGGGCAAAGACGACCAAGGCGACGCC
GACGCAAAGCCCAACTAG
Gene >Ophio5|4141
ATGGCTGCCCCCCAACCCCCCCCCCCCGCGCCCTTCTTCCCCTCCTCTTCCTTTAGCGACCTCCTTACCTTGCCG
ACCTACCTCTACCTACCGGACATTCTCCTCCCCGACGCTACCCGCTCAGTCTGCACTCGGCGGCGATACGACCTC
GAGCCCACTATGTTACAACACCTACGTCCCTCACGGCCTCTTCTCCTCCGGCTCGTCCCTTCGGCCTCAGCCCAG
CCTTTGTCACGATCTCCAGCGTCTGCTTCTCTTCGATGGCAGCCCGCCGCGATCTGGTCGCTCCCGCGGACACGC
CCCCTGCTCCGATTCGCAAGCAGCGACTCCAAAGCTCCTCCTCCGCAAAGGCGCGGCCAGCAGCAGCCGCCGACA
GTCGACAAGCGCGAGATACGCCCCGACCGGGTCTCAGAGCAGAGTACGGTGCGGCCGATATTCGAAAAGTCTCCG
CCGTCTGCGCCCGACAAAAATGCAGATCTGGGCCGCGATCTGAAGCATGATATCGTGAGAGCGAGCGAGAGAGCT
TGTGGCCAGCCTGCGCAACTGACCGGTGATAGGAAGCCTTTCGCGACACATTTCGCCTCGATGCTGTCCCTCGAG
AATCCCGCATCCTCGGCCTCGCCGGCACACTTCCCTATGTGGCAACCTCACTCTCGACTCTATTCTTAGCCTGGG
ATCTGAATAGAGACCCGCCGACGGGCAATTCTATGCTTGACCCGGTCTTCATCAACCACGACACTGCCCGGTATC
TCCTCGACCTTATTGAGCCGCTGCAGCTTGGCTACGGAGCCGTCATTATTTCCTTTCTCGGCGCAATTCACTGGG
TAAGGCAGCTCTTCCCCCCTCAGAGAAGGATGGAATGGCTGCACTGACACGGCGCCCATTCAGGGACTCGAGTAT
GCCGAGAAGCAGCCGTCGCTCGCGCGCACCCGCTTCCGTTACGGTATCGGCGTCGCCGCCTCCGTCGTGGCCTGG
CCTACCGTTCTCATGCCTATCGAGCACGCGCTCACCGCCCAATTCATGGCCTTTGCCGCCCTGTACTTGGTCGAC
TCGCGGGCGTCGGCGCGAGGATGGGCCCCCTCTTGGTACAACACCTACCGCTTCCTGCTCACGGCCATTGTCGGC
CTCGCCATCCTCGTGTCCCTGGTGGGGAGAGCAAACATTAGCGTCCACGGCAGGCTCAGCTCTTCAGGCCTGAGA
TCCAGCATGAACAACCCGGGAATCGCCGATCACCAAACCGACTGGGCTAAGTTGGAGAACGAGGAGAAGGCCAGA
ATCAAAAAGGAGGAGGAGAAGGCCAGGAAGAAGAAGGAGAAGGAAGAGGCTAAACGCAAGGCCAGTGGCAACAAG
GGAAAGAAGTCCGAGAAGGCCGAGAGGAAGGGTAATGCGGGCGGCAAAGAGACCGACGACGAAGAGAGCGACAAA
GATGAGGGCGAGAGCGAGGAGGACGAGGAGGACGGAAGGGCCGAGGATGACGGCGAGGACGAGGATGACGGTGAG
GACGAGGACGGCAAGGACGCCAACGGGGACGGCAAGAAGAAAGATGACAAGAGCAAGGACGCCAAAGAGGAAGGC
AAAAAGAAAGACGACAAGGGCAAAGACGACCAAGGCGACGCCGACGCAAAGCCCAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail