Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|414
Gene name
Locationscaffold_11:27285..28584
Strand+
Gene length (bp)1299
Transcript length (bp)750
Coding sequence length (bp)747
Protein length (aa) 249

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P25710|NUJM_NEUCR NADH-ubiquinone oxidoreductase 21.3 kDa subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B13D24.010 PE=4 SV=1 19 200 2.0E-43

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.5

Transmembrane Domains

Domain # Start End Length
1 60 82 22
2 114 136 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 123.66 67.78 179.54
CcL In ants, during behavior modification 75.16 38.48 111.84
CcD In ants, recently dead 146.38 79.32 213.43

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.028402 yes
SC16a CcD 0.494424 no
CcL CcD 0.004113 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|414
MEDRRKKTSAFAGEAEAPFVPHDVIGLTTKTGFIGAGAGLFIASIRNAMSRGNVGAMSVFIRGRGIIGMAAAAPA
TFAFFFAATSNLRQKTDTWAATFGGFMSGGVLGLPSRRLPVVLGLGAVVGIWQGSFFFLGNRIDSFYDEEDEFQR
KEIIRRTTRIPVEQTIAEIGEGPGITPQGYEERRRKRIKEKYGWDINPVDGVLAQPPRSREGRFSTSRAGRPPIS
PEGAGIRIGGRPVRFARITHTLRD
Coding >Ophio5|414
ATGGAAGACCGCCGCAAAAAAACATCAGCATTCGCTGGTGAAGCCGAGGCGCCGTTTGTTCCGCACGATGTCATC
GGCTTGACGACCAAGACAGGCTTCATCGGCGCCGGCGCCGGTCTCTTCATCGCCTCTATCCGCAACGCCATGTCG
CGAGGCAATGTTGGCGCTATGAGTGTCTTTATTCGTGGTCGCGGGATCATTGGCATGGCTGCTGCTGCCCCCGCT
ACTTTTGCCTTCTTCTTCGCTGCTACTTCGAACCTGCGGCAGAAGACGGACACTTGGGCTGCTACCTTTGGTGGC
TTCATGAGCGGCGGAGTCCTTGGCCTACCTTCGCGCCGACTGCCTGTCGTCCTCGGGCTCGGCGCCGTCGTCGGC
ATATGGCAGGGTAGCTTCTTCTTCTTGGGCAACCGCATCGACAGCTTCTATGACGAGGAGGACGAGTTCCAGCGC
AAGGAGATCATCCGACGAACCACCCGTATACCCGTCGAGCAGACCATTGCCGAGATTGGCGAGGGACCCGGCATC
ACGCCGCAGGGTTACGAGGAGCGTCGGCGCAAGCGCATCAAGGAAAAGTATGGCTGGGACATTAACCCGGTAGAC
GGAGTGCTCGCGCAGCCGCCGCGGTCTAGAGAAGGGAGGTTTTCTACTTCACGTGCCGGACGCCCTCCAATCAGC
CCCGAGGGTGCTGGCATCCGGATCGGAGGACGCCCGGTGCGTTTCGCAAGAATAACTCATACGCTTCGCGAC
Transcript >Ophio5|414
ATGGAAGACCGCCGCAAAAAAACATCAGCATTCGCTGGTGAAGCCGAGGCGCCGTTTGTTCCGCACGATGTCATC
GGCTTGACGACCAAGACAGGCTTCATCGGCGCCGGCGCCGGTCTCTTCATCGCCTCTATCCGCAACGCCATGTCG
CGAGGCAATGTTGGCGCTATGAGTGTCTTTATTCGTGGTCGCGGGATCATTGGCATGGCTGCTGCTGCCCCCGCT
ACTTTTGCCTTCTTCTTCGCTGCTACTTCGAACCTGCGGCAGAAGACGGACACTTGGGCTGCTACCTTTGGTGGC
TTCATGAGCGGCGGAGTCCTTGGCCTACCTTCGCGCCGACTGCCTGTCGTCCTCGGGCTCGGCGCCGTCGTCGGC
ATATGGCAGGGTAGCTTCTTCTTCTTGGGCAACCGCATCGACAGCTTCTATGACGAGGAGGACGAGTTCCAGCGC
AAGGAGATCATCCGACGAACCACCCGTATACCCGTCGAGCAGACCATTGCCGAGATTGGCGAGGGACCCGGCATC
ACGCCGCAGGGTTACGAGGAGCGTCGGCGCAAGCGCATCAAGGAAAAGTATGGCTGGGACATTAACCCGGTAGAC
GGAGTGCTCGCGCAGCCGCCGCGGTCTAGAGAAGGGAGGTTTTCTACTTCACGTGCCGGACGCCCTCCAATCAGC
CCCGAGGGTGCTGGCATCCGGATCGGAGGACGCCCGGTGCGTTTCGCAAGAATAACTCATACGCTTCGCGACTAA
Gene >Ophio5|414
ATGGAAGACCGCCGCAAAAAAACATCAGCATTCGCTGGTGAAGCCGAGGCGCCGTTTGTTCCGCACGATGTCATC
GGCTTGACGACCAAGACAGGCTTCATCGGCGCCGGCGCCGGTCTCTTCATCGCCTCTATCCGCAACGCCATGTCG
CGAGGCAATGTTGGCGCTATGAGTGTCTTTATTCGTGGTCGCGGGATCATTGGCATGGCTGGTCCGTCTCTCCAC
CGCAGAGCTTTCGGAAAAACCTCCGCCCTGCGCGTGCTCGTCTCTCTTTCAACCCTCGATGGGCTGACGTGCTAT
TGTGCCCCTCGTCTTCGTCTGGGTTGGCAGCTGCTGCCCCCGCTACTTTTGCCTTCTTCTTCGCTGCTACTTCGA
ACCTGCGGCAGAAGACGGACACTTGGGCTGCTACCTTTGGTGGCTTCATGAGCGGCGGAGTCCTTGGCCTACCTT
GTACTTTCTCCCTCTCCCCCTTGTGCTACTGCGGCTAAGTGCCCCCTTTCCCTTACAGCGCGCCGACTGCCTGTC
GTCCTCGGGCTCGGCGCCGTCGTCGGCATATGGCAGGGTAGCTTCTTCTTCTTGGGCAACCGCATCGACAGCTTC
TATGACGAGGAGGACGAGTTCCAGCGCAAGGAGATCATCCGACGAACCACCCGTATACCCGTCGAGCAGACCATT
GCCGAGATTGGCGAGGGACCCGGTGAGCAACTCCTCTGTTTTCGTTCTCCAACACCTGCCGCTGACCGGCCTTGC
CTTCCCAGGCATCACGCCGCAGGGTTACGAGGAGCGTCGGCGCAAGCGCATCAAGGAAAAGTATGGCTGGGACAT
TAACCCGGTCAGTGCCACCATCGATGGCAGCCATTAAGCCTCGCTGCGGGAGAGCCTGTTTGGCACTGTGCAAGG
CACCGCGTCCCAGGTAGACGGAGTGCTCGCGCAGCCGCCGCGGTCTAGAGAAGGGAGGTTTTCTACTTCACGTGC
CGGACGCCCTCCAATCAGCCCCGAGGGTGCTGGCATCCGGATCGGAGGACGCCCGGTGCGTTTCGCAAGGTAAGC
TCCTTCTCAAGCAAGATTACCTCTCGCCTTTCTCTTTCTTGTTGCCATCGTGATGAACCTATCGAGTCAGAGGCT
GTTTATGACGTACCCTGATTACAAGACTCACCAAAATCTACATTGTCTACCTGAAGCTGGCCCCTTTTTTCCTAT
ACTGCCTTCTCATCTGTCGTGGCGGGGACCTGGGTCCGCCGTGTGGATCAGCGGCTAACCATGAGGCTTCGCAGA
ATAACTCATACGCTTCGCGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail