Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4130
Gene name
Locationscaffold_323:15551..17496
Strand-
Gene length (bp)1945
Transcript length (bp)1884
Coding sequence length (bp)1881
Protein length (aa) 627

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11500 Cut12 Cut12 conserved domain 1.2E-42 138 247

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal|Nuclear export signal 0.5892 0.4792 0.1649 0.1086 0.1767 0.0362 0.1161 0.1907 0.4536 0.0086

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2458
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1335
Ophiocordyceps australis map64 (Brazil) OphauB2|6010
Ophiocordyceps camponoti-floridani Ophcf2|06800
Ophiocordyceps camponoti-rufipedis Ophun1|1126
Ophiocordyceps kimflemingae Ophio5|4130 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3534

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4130
MLGWMLRGGDHAPNAPDAEAQEDATRVELPDTPAPVFAARALKSALFGTPARADDSPRRQKTKASRRTSTMAKAD
KGSSGTPSKPPGILLTPGTGTSRRKRVSFGQQVTDFDPTGGNGGATQRADTVAKPTTDAGGATSKAADDTDDDWE
EEDDDGCCTHDVTLDLNEPHSQSGRYWKGQFERYHQEAKAEMEKLLKYKQLAKSYARQKDAEAVRLSERLRDERQ
RVIKMEMKIADNASQIVSRHGDNGPDGEPTELLAKLTKQTALAADYRQRVHDLETKLDDVVRQKEQSAEASGRRR
RVATTASPTTQKTLLETQRELRRARVQLKELDSLRHEVSLLKTRVKTAETRAHAGDKQDVDESMSTRHGRLRTQL
DESREEGRQKAEELRQLKHDFEAFKKESEAHEAETRAVLQRAHSKISDLKKEMRVLKAADTGKCRPSGRCPSPDD
NGLEARRDKTAQDGRSRGRDVTGKDSNSKRSTEEGALTERTNAERPRWQPFVARSPRVVRGSSDQGQSGSGRWKP
GAEEQPVRPQTKSNSQEQQQQQQQHQQPGRTRRKASDDDDDDDDDVDDVPRCKPEANDEAKATTKRRSSVLPPDR
RAAALARIESRLEEKRRRAHDKENRRP
Coding >Ophio5|4130
ATGCTTGGATGGATGCTGCGGGGCGGCGATCACGCGCCAAACGCGCCAGACGCTGAAGCTCAGGAAGACGCGACT
CGAGTTGAGCTGCCCGACACGCCCGCGCCCGTCTTCGCGGCCCGAGCTTTGAAAAGCGCCCTCTTCGGTACGCCT
GCTCGGGCCGACGATTCGCCACGACGGCAGAAGACGAAAGCAAGCCGGCGGACTAGCACTATGGCCAAGGCAGAC
AAGGGCTCATCGGGCACGCCGTCTAAGCCGCCCGGAATCCTACTCACGCCCGGGACCGGCACCTCGCGACGGAAG
CGCGTCTCCTTCGGCCAACAAGTCACGGATTTCGACCCAACAGGGGGCAACGGCGGCGCGACGCAACGAGCGGAC
ACGGTAGCAAAGCCCACGACCGACGCTGGCGGTGCTACCTCGAAAGCGGCCGATGACACCGATGACGACTGGGAA
GAGGAAGACGACGACGGTTGCTGCACGCACGACGTGACGCTGGACCTCAACGAGCCTCACTCGCAGTCAGGGCGG
TACTGGAAGGGACAATTCGAGAGATATCACCAAGAAGCCAAGGCAGAAATGGAGAAGCTGCTCAAGTATAAGCAA
CTGGCCAAATCCTATGCCCGGCAAAAGGACGCCGAGGCCGTCCGACTCTCCGAGCGGCTTCGAGACGAGCGGCAG
CGGGTCATTAAGATGGAGATGAAGATTGCAGACAACGCATCCCAGATTGTCTCGAGACACGGCGACAACGGCCCG
GATGGAGAGCCGACAGAGCTTCTGGCCAAGCTCACCAAGCAGACTGCTCTCGCGGCCGATTATCGGCAGCGCGTC
CACGATCTCGAGACGAAGTTGGACGACGTCGTACGGCAGAAGGAACAAAGCGCCGAAGCCAGCGGTCGACGCAGG
CGAGTGGCGACGACAGCATCACCGACGACGCAGAAGACGCTACTCGAGACGCAGCGGGAACTCCGCCGAGCTCGG
GTGCAACTGAAGGAGCTCGATTCTCTTCGGCACGAGGTTTCCCTCCTCAAGACCCGCGTCAAGACGGCTGAGACG
CGGGCCCACGCAGGCGACAAGCAAGACGTGGACGAATCGATGAGCACTAGACATGGCAGACTGAGAACTCAGTTG
GACGAGTCGAGAGAGGAGGGGCGACAAAAGGCAGAAGAGCTACGGCAGCTTAAGCATGACTTTGAAGCCTTCAAG
AAGGAGAGCGAAGCACACGAGGCCGAGACGCGGGCGGTGCTACAGCGAGCGCACAGCAAGATTTCCGATCTGAAA
AAGGAGATGCGGGTTCTCAAAGCCGCCGATACGGGTAAATGCCGACCTAGTGGCAGATGCCCCTCGCCCGACGAC
AACGGCCTCGAGGCGAGAAGGGACAAGACTGCGCAGGACGGACGCTCAAGAGGCCGAGACGTCACTGGAAAGGAC
TCGAACTCGAAGCGCTCGACGGAAGAGGGCGCGTTGACGGAGCGAACAAACGCGGAAAGGCCTAGATGGCAGCCA
TTCGTCGCGAGATCACCGAGGGTCGTCCGTGGCTCGAGCGACCAAGGGCAATCCGGAAGCGGCCGATGGAAGCCG
GGCGCTGAGGAGCAACCTGTACGCCCTCAAACGAAGTCCAACAGCCAAGAACAGCAGCAGCAGCAGCAGCAGCAT
CAGCAGCCTGGACGAACCCGAAGGAAGGCCAGCGACGACGACGACGACGACGACGACGACGTGGACGACGTCCCA
CGGTGCAAGCCCGAGGCAAACGACGAGGCCAAGGCGACAACCAAGCGCCGAAGCAGCGTTCTTCCCCCCGACCGC
CGCGCCGCCGCTCTGGCTCGAATCGAGAGCCGATTGGAGGAGAAGCGACGCAGGGCACATGACAAAGAGAATCGG
CGGCCG
Transcript >Ophio5|4130
ATGCTTGGATGGATGCTGCGGGGCGGCGATCACGCGCCAAACGCGCCAGACGCTGAAGCTCAGGAAGACGCGACT
CGAGTTGAGCTGCCCGACACGCCCGCGCCCGTCTTCGCGGCCCGAGCTTTGAAAAGCGCCCTCTTCGGTACGCCT
GCTCGGGCCGACGATTCGCCACGACGGCAGAAGACGAAAGCAAGCCGGCGGACTAGCACTATGGCCAAGGCAGAC
AAGGGCTCATCGGGCACGCCGTCTAAGCCGCCCGGAATCCTACTCACGCCCGGGACCGGCACCTCGCGACGGAAG
CGCGTCTCCTTCGGCCAACAAGTCACGGATTTCGACCCAACAGGGGGCAACGGCGGCGCGACGCAACGAGCGGAC
ACGGTAGCAAAGCCCACGACCGACGCTGGCGGTGCTACCTCGAAAGCGGCCGATGACACCGATGACGACTGGGAA
GAGGAAGACGACGACGGTTGCTGCACGCACGACGTGACGCTGGACCTCAACGAGCCTCACTCGCAGTCAGGGCGG
TACTGGAAGGGACAATTCGAGAGATATCACCAAGAAGCCAAGGCAGAAATGGAGAAGCTGCTCAAGTATAAGCAA
CTGGCCAAATCCTATGCCCGGCAAAAGGACGCCGAGGCCGTCCGACTCTCCGAGCGGCTTCGAGACGAGCGGCAG
CGGGTCATTAAGATGGAGATGAAGATTGCAGACAACGCATCCCAGATTGTCTCGAGACACGGCGACAACGGCCCG
GATGGAGAGCCGACAGAGCTTCTGGCCAAGCTCACCAAGCAGACTGCTCTCGCGGCCGATTATCGGCAGCGCGTC
CACGATCTCGAGACGAAGTTGGACGACGTCGTACGGCAGAAGGAACAAAGCGCCGAAGCCAGCGGTCGACGCAGG
CGAGTGGCGACGACAGCATCACCGACGACGCAGAAGACGCTACTCGAGACGCAGCGGGAACTCCGCCGAGCTCGG
GTGCAACTGAAGGAGCTCGATTCTCTTCGGCACGAGGTTTCCCTCCTCAAGACCCGCGTCAAGACGGCTGAGACG
CGGGCCCACGCAGGCGACAAGCAAGACGTGGACGAATCGATGAGCACTAGACATGGCAGACTGAGAACTCAGTTG
GACGAGTCGAGAGAGGAGGGGCGACAAAAGGCAGAAGAGCTACGGCAGCTTAAGCATGACTTTGAAGCCTTCAAG
AAGGAGAGCGAAGCACACGAGGCCGAGACGCGGGCGGTGCTACAGCGAGCGCACAGCAAGATTTCCGATCTGAAA
AAGGAGATGCGGGTTCTCAAAGCCGCCGATACGGGTAAATGCCGACCTAGTGGCAGATGCCCCTCGCCCGACGAC
AACGGCCTCGAGGCGAGAAGGGACAAGACTGCGCAGGACGGACGCTCAAGAGGCCGAGACGTCACTGGAAAGGAC
TCGAACTCGAAGCGCTCGACGGAAGAGGGCGCGTTGACGGAGCGAACAAACGCGGAAAGGCCTAGATGGCAGCCA
TTCGTCGCGAGATCACCGAGGGTCGTCCGTGGCTCGAGCGACCAAGGGCAATCCGGAAGCGGCCGATGGAAGCCG
GGCGCTGAGGAGCAACCTGTACGCCCTCAAACGAAGTCCAACAGCCAAGAACAGCAGCAGCAGCAGCAGCAGCAT
CAGCAGCCTGGACGAACCCGAAGGAAGGCCAGCGACGACGACGACGACGACGACGACGACGTGGACGACGTCCCA
CGGTGCAAGCCCGAGGCAAACGACGAGGCCAAGGCGACAACCAAGCGCCGAAGCAGCGTTCTTCCCCCCGACCGC
CGCGCCGCCGCTCTGGCTCGAATCGAGAGCCGATTGGAGGAGAAGCGACGCAGGGCACATGACAAAGAGAATCGG
CGGCCGTGA
Gene >Ophio5|4130
ATGCTTGGATGGATGCTGCGGGGCGGCGATCACGCGCCAAACGCGCCAGACGCTGAAGCTCAGGAAGGTTTGTGC
TGGCATCCGTGGAAGAACAAGACAGCTGAAGCTGATATCAAACCCTTTCGCAGACGCGACTCGAGTTGAGCTGCC
CGACACGCCCGCGCCCGTCTTCGCGGCCCGAGCTTTGAAAAGCGCCCTCTTCGGTACGCCTGCTCGGGCCGACGA
TTCGCCACGACGGCAGAAGACGAAAGCAAGCCGGCGGACTAGCACTATGGCCAAGGCAGACAAGGGCTCATCGGG
CACGCCGTCTAAGCCGCCCGGAATCCTACTCACGCCCGGGACCGGCACCTCGCGACGGAAGCGCGTCTCCTTCGG
CCAACAAGTCACGGATTTCGACCCAACAGGGGGCAACGGCGGCGCGACGCAACGAGCGGACACGGTAGCAAAGCC
CACGACCGACGCTGGCGGTGCTACCTCGAAAGCGGCCGATGACACCGATGACGACTGGGAAGAGGAAGACGACGA
CGGTTGCTGCACGCACGACGTGACGCTGGACCTCAACGAGCCTCACTCGCAGTCAGGGCGGTACTGGAAGGGACA
ATTCGAGAGATATCACCAAGAAGCCAAGGCAGAAATGGAGAAGCTGCTCAAGTATAAGCAACTGGCCAAATCCTA
TGCCCGGCAAAAGGACGCCGAGGCCGTCCGACTCTCCGAGCGGCTTCGAGACGAGCGGCAGCGGGTCATTAAGAT
GGAGATGAAGATTGCAGACAACGCATCCCAGATTGTCTCGAGACACGGCGACAACGGCCCGGATGGAGAGCCGAC
AGAGCTTCTGGCCAAGCTCACCAAGCAGACTGCTCTCGCGGCCGATTATCGGCAGCGCGTCCACGATCTCGAGAC
GAAGTTGGACGACGTCGTACGGCAGAAGGAACAAAGCGCCGAAGCCAGCGGTCGACGCAGGCGAGTGGCGACGAC
AGCATCACCGACGACGCAGAAGACGCTACTCGAGACGCAGCGGGAACTCCGCCGAGCTCGGGTGCAACTGAAGGA
GCTCGATTCTCTTCGGCACGAGGTTTCCCTCCTCAAGACCCGCGTCAAGACGGCTGAGACGCGGGCCCACGCAGG
CGACAAGCAAGACGTGGACGAATCGATGAGCACTAGACATGGCAGACTGAGAACTCAGTTGGACGAGTCGAGAGA
GGAGGGGCGACAAAAGGCAGAAGAGCTACGGCAGCTTAAGCATGACTTTGAAGCCTTCAAGAAGGAGAGCGAAGC
ACACGAGGCCGAGACGCGGGCGGTGCTACAGCGAGCGCACAGCAAGATTTCCGATCTGAAAAAGGAGATGCGGGT
TCTCAAAGCCGCCGATACGGGTAAATGCCGACCTAGTGGCAGATGCCCCTCGCCCGACGACAACGGCCTCGAGGC
GAGAAGGGACAAGACTGCGCAGGACGGACGCTCAAGAGGCCGAGACGTCACTGGAAAGGACTCGAACTCGAAGCG
CTCGACGGAAGAGGGCGCGTTGACGGAGCGAACAAACGCGGAAAGGCCTAGATGGCAGCCATTCGTCGCGAGATC
ACCGAGGGTCGTCCGTGGCTCGAGCGACCAAGGGCAATCCGGAAGCGGCCGATGGAAGCCGGGCGCTGAGGAGCA
ACCTGTACGCCCTCAAACGAAGTCCAACAGCCAAGAACAGCAGCAGCAGCAGCAGCAGCATCAGCAGCCTGGACG
AACCCGAAGGAAGGCCAGCGACGACGACGACGACGACGACGACGACGTGGACGACGTCCCACGGTGCAAGCCCGA
GGCAAACGACGAGGCCAAGGCGACAACCAAGCGCCGAAGCAGCGTTCTTCCCCCCGACCGCCGCGCCGCCGCTCT
GGCTCGAATCGAGAGCCGATTGGAGGAGAAGCGACGCAGGGCACATGACAAAGAGAATCGGCGGCCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail