Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4120
Gene name
Locationscaffold_322:21085..22814
Strand+
Gene length (bp)1729
Transcript length (bp)1482
Coding sequence length (bp)1479
Protein length (aa) 493

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08743 Nse4_C Nse4 C-terminal 2.1E-32 387 475
PF15412 Nse4-Nse3_bdg Binding domain of Nse4/EID3 to Nse3-MAGE 2.4E-17 179 232

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BDR8|NSE4_SCHPO Non-structural maintenance of chromosome element 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nse4 PE=1 SV=1 126 492 2.0E-23
sp|Q8N140|EID3_HUMAN EP300-interacting inhibitor of differentiation 3 OS=Homo sapiens GN=EID3 PE=1 SV=1 96 477 3.0E-20
sp|P43124|NSE4_YEAST Non-structural maintenance of chromosome element 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSE4 PE=1 SV=1 264 476 2.0E-18
sp|Q9NXX6|NSE4A_HUMAN Non-structural maintenance of chromosomes element 4 homolog A OS=Homo sapiens GN=NSMCE4A PE=1 SV=2 100 475 9.0E-18
sp|Q3V124|EID3_MOUSE EP300-interacting inhibitor of differentiation 3 OS=Mus musculus GN=Eid3 PE=1 SV=1 125 477 2.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BDR8|NSE4_SCHPO Non-structural maintenance of chromosome element 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nse4 PE=1 SV=1 126 492 2.0E-23
sp|Q8N140|EID3_HUMAN EP300-interacting inhibitor of differentiation 3 OS=Homo sapiens GN=EID3 PE=1 SV=1 96 477 3.0E-20
sp|P43124|NSE4_YEAST Non-structural maintenance of chromosome element 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSE4 PE=1 SV=1 264 476 2.0E-18
sp|Q9NXX6|NSE4A_HUMAN Non-structural maintenance of chromosomes element 4 homolog A OS=Homo sapiens GN=NSMCE4A PE=1 SV=2 100 475 9.0E-18
sp|Q3V124|EID3_MOUSE EP300-interacting inhibitor of differentiation 3 OS=Mus musculus GN=Eid3 PE=1 SV=1 125 477 2.0E-17
sp|A6QPC8|EID3_BOVIN EP300-interacting inhibitor of differentiation 3 OS=Bos taurus GN=EID3 PE=2 SV=1 387 475 2.0E-15
sp|Q4V8G2|EID3_RAT EP300-interacting inhibitor of differentiation 3 OS=Rattus norvegicus GN=Eid3 PE=2 SV=2 390 477 4.0E-15
sp|Q2TBI1|NSE4A_BOVIN Non-structural maintenance of chromosomes element 4 homolog A OS=Bos taurus GN=NSMCE4A PE=2 SV=1 387 475 4.0E-15
sp|A5LFW4|EID3_MACFA EP300-interacting inhibitor of differentiation 3 OS=Macaca fascicularis GN=EID3 PE=2 SV=1 390 477 5.0E-15
sp|Q9C689|NSE4A_ARATH Non-structural maintenance of chromosomes element 4 homolog A OS=Arabidopsis thaliana GN=NSE4A PE=2 SV=1 124 479 8.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4120
MICRARRFAGPPRRREKGRREKGRREEDVTDKTDRQDRRTDRQSDASAMPTRLQHPDDDDDASSVRSPSSPSLSL
RNPSPDAAKRKRVDFTNGQPSRRRRHSAEDAGSSNSDMDDDVYDPDQPLEERRTVQRSYRDLMRELVEKGDEYLG
SDSYGLHETILKADELSKKLRQTTEATIDSRLLVSTTDLSYRKALRLTQGSLSQGIDTDELVSKCITYMRNGAGI
ADNDAPELSSTQRQRRRAPRVSAADAEDDDDDDEEDIGDEGDMMNWSHLGRFACLPHLRRPALPGFLLGPLSVEK
KARRLYKRSAPFRPNNLTETRPEVLNVDDLAHKENDLTVICGKILQQLQKMQAHTQETVAELMEDDMDDAEKTTI
MHQHGLRSTGGLDLMRFVVNPKSFAQTVENIFYVSFLIRDGRIQIEMDEYDLPSLAPVDREADDRGGARHGASKH
QAVLSMDMRTWRETVQTFNMTEPMIEHRREASSSGPGARSWYS
Coding >Ophio5|4120
ATGATCTGTCGCGCGCGTCGATTTGCGGGGCCGCCTCGACGACGCGAAAAAGGACGACGCGAAAAAGGACGACGC
GAAGAGGACGTCACAGACAAGACAGACAGACAAGACAGACGGACAGACAGACAGTCTGACGCGTCTGCCATGCCG
ACGCGTCTTCAGCATCCGGACGACGACGATGACGCCTCCTCCGTCAGATCGCCGTCCTCGCCGAGCCTCTCCCTT
AGAAATCCTTCCCCCGACGCAGCCAAGCGGAAGCGCGTCGACTTCACCAATGGCCAGCCGAGCCGCCGTCGGAGG
CACTCGGCAGAAGACGCCGGCAGCAGCAACAGCGACATGGACGATGACGTCTACGATCCGGATCAGCCGTTGGAA
GAGCGCCGCACCGTCCAGAGGAGCTATCGCGATCTGATGCGCGAGCTCGTCGAAAAGGGCGACGAGTATCTCGGC
TCCGACTCCTACGGCCTGCACGAGACCATCCTCAAGGCCGACGAGCTGTCCAAGAAGCTGCGCCAGACGACAGAA
GCCACCATCGACTCGCGTCTGCTCGTCAGCACCACCGATCTATCTTACCGCAAGGCCCTACGTCTCACACAGGGC
AGCCTGTCGCAGGGCATCGACACCGACGAGCTCGTCTCCAAGTGCATAACGTACATGAGGAATGGCGCCGGCATC
GCTGACAATGACGCCCCCGAGCTGTCTAGCACGCAAAGACAGCGTCGGAGGGCACCTCGTGTCTCTGCCGCCGAC
GCGGAGGACGACGACGACGACGACGAAGAGGACATTGGCGACGAGGGAGATATGATGAACTGGTCTCATCTCGGA
CGCTTCGCCTGTCTGCCGCATCTGCGTCGCCCTGCCCTGCCCGGCTTCCTTCTAGGACCGCTTTCGGTCGAGAAG
AAGGCGCGCAGGCTCTACAAACGGAGCGCTCCCTTTCGTCCCAATAACTTGACAGAGACGAGGCCCGAGGTGCTC
AACGTCGACGATCTGGCTCACAAGGAGAACGACCTGACGGTCATTTGCGGCAAGATTCTGCAGCAGCTCCAAAAG
ATGCAAGCCCATACTCAGGAGACGGTGGCCGAGTTGATGGAGGACGACATGGATGACGCGGAAAAGACGACCATC
ATGCACCAGCACGGCCTCCGCAGTACCGGCGGCCTCGACCTGATGCGATTCGTCGTCAACCCCAAGTCCTTTGCC
CAGACGGTTGAGAATATCTTCTACGTCAGCTTCCTCATCCGCGATGGGAGGATACAAATCGAGATGGACGAATAC
GACCTCCCGTCTCTCGCACCGGTCGACCGGGAAGCAGACGACCGAGGCGGTGCCCGCCACGGCGCGTCAAAGCAC
CAAGCCGTGCTATCGATGGACATGAGGACCTGGCGTGAAACAGTCCAAACCTTTAACATGACGGAACCCATGATT
GAACACCGACGAGAAGCATCCAGCTCTGGCCCGGGCGCACGCAGCTGGTACAGC
Transcript >Ophio5|4120
ATGATCTGTCGCGCGCGTCGATTTGCGGGGCCGCCTCGACGACGCGAAAAAGGACGACGCGAAAAAGGACGACGC
GAAGAGGACGTCACAGACAAGACAGACAGACAAGACAGACGGACAGACAGACAGTCTGACGCGTCTGCCATGCCG
ACGCGTCTTCAGCATCCGGACGACGACGATGACGCCTCCTCCGTCAGATCGCCGTCCTCGCCGAGCCTCTCCCTT
AGAAATCCTTCCCCCGACGCAGCCAAGCGGAAGCGCGTCGACTTCACCAATGGCCAGCCGAGCCGCCGTCGGAGG
CACTCGGCAGAAGACGCCGGCAGCAGCAACAGCGACATGGACGATGACGTCTACGATCCGGATCAGCCGTTGGAA
GAGCGCCGCACCGTCCAGAGGAGCTATCGCGATCTGATGCGCGAGCTCGTCGAAAAGGGCGACGAGTATCTCGGC
TCCGACTCCTACGGCCTGCACGAGACCATCCTCAAGGCCGACGAGCTGTCCAAGAAGCTGCGCCAGACGACAGAA
GCCACCATCGACTCGCGTCTGCTCGTCAGCACCACCGATCTATCTTACCGCAAGGCCCTACGTCTCACACAGGGC
AGCCTGTCGCAGGGCATCGACACCGACGAGCTCGTCTCCAAGTGCATAACGTACATGAGGAATGGCGCCGGCATC
GCTGACAATGACGCCCCCGAGCTGTCTAGCACGCAAAGACAGCGTCGGAGGGCACCTCGTGTCTCTGCCGCCGAC
GCGGAGGACGACGACGACGACGACGAAGAGGACATTGGCGACGAGGGAGATATGATGAACTGGTCTCATCTCGGA
CGCTTCGCCTGTCTGCCGCATCTGCGTCGCCCTGCCCTGCCCGGCTTCCTTCTAGGACCGCTTTCGGTCGAGAAG
AAGGCGCGCAGGCTCTACAAACGGAGCGCTCCCTTTCGTCCCAATAACTTGACAGAGACGAGGCCCGAGGTGCTC
AACGTCGACGATCTGGCTCACAAGGAGAACGACCTGACGGTCATTTGCGGCAAGATTCTGCAGCAGCTCCAAAAG
ATGCAAGCCCATACTCAGGAGACGGTGGCCGAGTTGATGGAGGACGACATGGATGACGCGGAAAAGACGACCATC
ATGCACCAGCACGGCCTCCGCAGTACCGGCGGCCTCGACCTGATGCGATTCGTCGTCAACCCCAAGTCCTTTGCC
CAGACGGTTGAGAATATCTTCTACGTCAGCTTCCTCATCCGCGATGGGAGGATACAAATCGAGATGGACGAATAC
GACCTCCCGTCTCTCGCACCGGTCGACCGGGAAGCAGACGACCGAGGCGGTGCCCGCCACGGCGCGTCAAAGCAC
CAAGCCGTGCTATCGATGGACATGAGGACCTGGCGTGAAACAGTCCAAACCTTTAACATGACGGAACCCATGATT
GAACACCGACGAGAAGCATCCAGCTCTGGCCCGGGCGCACGCAGCTGGTACAGCTAG
Gene >Ophio5|4120
ATGATCTGTCGCGCGCGGTACGTACCGATCACGAGCGAGACATTTTTCGGCCGAATTAAGAAGGGAATTATGGAG
TCGATTTGCGGGGCCGCCTCGACGACGCGAAAAAGGACGACGCGAAAAAGGACGACGCGAAGAGGACGTCGTCAG
TCCAAGCAGAGGATAGGGCAAGGGCCAATAACCGATATTGTCTTTGTTGAGTCATCTTGGAAAGTCGGACACTGC
CTGCTTCGCGTGACAGCATCCAGACAGACAAGACAGACAGACAAGACAGACGGACAGACAGACAGTCTGACGCGT
CTGCCATGCCGACGCGTCTTCAGCATCCGGACGACGACGATGACGCCTCCTCCGTCAGATCGCCGTCCTCGCCGA
GCCTCTCCCTTAGAAATCCTTCCCCCGACGCAGCCAAGCGGAAGCGCGTCGACTTCACCAATGGCCAGCCGAGCC
GCCGTCGGAGGCACTCGGCAGAAGACGCCGGCAGCAGCAACAGCGACATGGACGATGACGTCTACGATCCGGATC
AGCCGTTGGAAGAGCGCCGCACCGTCCAGAGGAGCTATCGCGATCTGATGCGCGAGCTCGTCGAAAAGGGCGACG
AGTATCTCGGCTCCGACTCCTACGGCCTGCACGAGACCATCCTCAAGGCCGACGAGCTGTCCAAGAAGCTGCGCC
AGACGACAGAAGCCACCATCGACTCGCGTCTGCTCGTCAGCACCACCGATCTATCTTACCGCAAGGCCCTACGTC
TCACACAGGGCAGCCTGTCGCAGGGCATCGACACCGACGAGCTCGTCTCCAAGTGCATAACGTACATGAGGAATG
GCGCCGGCATCGCTGACAATGACGCCCCCGAGCTGTCTAGCACGCAAAGACAGCGTCGGAGGGCACCTCGTGTCT
CTGCCGCCGACGCGGAGGACGACGACGACGACGACGAAGAGGACATTGGCGACGAGGGAGATATGATGAACTGGT
CTCATCTCGGACGCTTCGCCTGTCTGCCGCATCTGCGTCGCCCTGCCCTGCCCGGCTTCCTTCTAGGACCGCTTT
CGGTCGAGAAGAAGGCGCGCAGGCTCTACAAACGGAGCGCTCCCTTTCGTCCCAATAACTTGACAGAGACGAGGC
CCGAGGTGCTCAACGTCGACGATCTGGCTCACAAGGAGAACGACCTGACGGTCATTTGCGGCAAGATTCTGCAGC
AGCTCCAAAAGATGCAAGCCCATACTCAGGAGACGGTGGCCGAGTTGATGGAGGACGACATGGATGACGCGGAAA
AGACGACCATCATGCACCAGCACGGCCTCCGCAGTACCGGCGGCCTCGACCTGATGCGATTCGTCGTCAACCCCA
AGTCCTTTGCCCAGACGGTTGAGAATATCTTCTACGTCAGCTTCCTCATCCGCGATGGGAGGATACAAATCGAGA
TGGACGAATACGACCTCCCGTCTCTCGGTGAGTTCTTCTTCTTCTTCTTCTTCTTCTTTCCCCCTTCCGGTAATG
AAAAACCCCCCCCACGGGTCTGACCCTTTCCTCGGCAGCACCGGTCGACCGGGAAGCAGACGACCGAGGCGGTGC
CCGCCACGGCGCGTCAAAGCACCAAGCCGTGCTATCGATGGACATGAGGACCTGGCGTGAAACAGTCCAAACCTT
TAACATGACGGAACCCATGATTGAACACCGACGAGAAGCATCCAGCTCTGGCCCGGGCGCACGCAGCTGGTACAG
CTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail