Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4118
Gene name
Locationscaffold_322:17973..18731
Strand+
Gene length (bp)758
Transcript length (bp)486
Coding sequence length (bp)483
Protein length (aa) 161

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00137 ATP-synt_C ATP synthase subunit C 7.3E-10 17 75
PF00137 ATP-synt_C ATP synthase subunit C 8.2E-17 96 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y874|VATL2_NEUCR V-type proton ATPase 16 kDa proteolipid subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-11 PE=2 SV=2 2 161 3.0E-93
sp|Q6BSB9|VATL2_DEBHA V-type proton ATPase 16 kDa proteolipid subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VMA11 PE=3 SV=1 3 161 2.0E-68
sp|Q755G4|VATL2_ASHGO V-type proton ATPase 16 kDa proteolipid subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VMA11 PE=3 SV=1 3 161 1.0E-67
sp|Q6CT28|VATL2_KLULA V-type proton ATPase 16 kDa proteolipid subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VMA11 PE=3 SV=1 2 161 2.0E-66
sp|P32842|VATL2_YEAST V-type proton ATPase subunit c' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA11 PE=1 SV=1 6 158 9.0E-66
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y874|VATL2_NEUCR V-type proton ATPase 16 kDa proteolipid subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-11 PE=2 SV=2 2 161 3.0E-93
sp|Q6BSB9|VATL2_DEBHA V-type proton ATPase 16 kDa proteolipid subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VMA11 PE=3 SV=1 3 161 2.0E-68
sp|Q755G4|VATL2_ASHGO V-type proton ATPase 16 kDa proteolipid subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VMA11 PE=3 SV=1 3 161 1.0E-67
sp|Q6CT28|VATL2_KLULA V-type proton ATPase 16 kDa proteolipid subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VMA11 PE=3 SV=1 2 161 2.0E-66
sp|P32842|VATL2_YEAST V-type proton ATPase subunit c' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA11 PE=1 SV=1 6 158 9.0E-66
sp|Q6FUY5|VATL2_CANGA V-type proton ATPase 16 kDa proteolipid subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VMA11 PE=3 SV=1 2 158 1.0E-64
sp|Q9URZ8|VATL2_SCHPO V-type proton ATPase 16 kDa proteolipid subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma11 PE=3 SV=1 1 160 2.0E-63
sp|P31413|VATL_NEUCR V-type proton ATPase 16 kDa proteolipid subunit OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-3 PE=2 SV=1 3 160 4.0E-59
sp|Q26250|VATL_NEPNO V-type proton ATPase 16 kDa proteolipid subunit OS=Nephrops norvegicus PE=2 SV=1 1 160 1.0E-58
sp|P50515|VATL_SCHPO V-type proton ATPase 16 kDa proteolipid subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma3 PE=3 SV=1 1 160 2.0E-58
sp|Q00607|VATL_CANTR V-type proton ATPase 16 kDa proteolipid subunit OS=Candida tropicalis GN=VMA3 PE=3 SV=1 3 160 9.0E-58
sp|P55277|VATL_HELVI V-type proton ATPase 16 kDa proteolipid subunit OS=Heliothis virescens GN=VHA16 PE=2 SV=1 7 159 2.0E-57
sp|P31403|VATL_MANSE V-type proton ATPase 16 kDa proteolipid subunit OS=Manduca sexta GN=VHA16 PE=2 SV=1 7 159 3.0E-57
sp|O16110|VATL_AEDAE V-type proton ATPase 16 kDa proteolipid subunit OS=Aedes aegypti GN=AAEL000291 PE=2 SV=2 4 158 6.0E-57
sp|P25515|VATL1_YEAST V-type proton ATPase subunit c OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA3 PE=1 SV=1 3 160 8.0E-57
sp|Q03105|VATL_TORMA V-type proton ATPase 16 kDa proteolipid subunit OS=Torpedo marmorata PE=1 SV=1 1 158 1.0E-56
sp|P23380|VATL_DROME V-type proton ATPase 16 kDa proteolipid subunit OS=Drosophila melanogaster GN=Vha16-1 PE=2 SV=1 1 158 2.0E-56
sp|P27449|VATL_HUMAN V-type proton ATPase 16 kDa proteolipid subunit OS=Homo sapiens GN=ATP6V0C PE=1 SV=1 2 158 4.0E-56
sp|O18882|VATL_SHEEP V-type proton ATPase 16 kDa proteolipid subunit OS=Ovis aries GN=ATP6V0C PE=2 SV=1 2 158 1.0E-55
sp|P23956|VATL_BOVIN V-type proton ATPase 16 kDa proteolipid subunit OS=Bos taurus GN=ATP6V0C PE=1 SV=1 2 158 2.0E-55
sp|Q43362|VATL_CHRCT V-type proton ATPase 16 kDa proteolipid subunit OS=Chrysotila carteri GN=VAP PE=2 SV=1 3 159 1.0E-54
sp|P63081|VATL_RAT V-type proton ATPase 16 kDa proteolipid subunit OS=Rattus norvegicus GN=Atp6v0c PE=2 SV=1 7 158 6.0E-54
sp|P63082|VATL_MOUSE V-type proton ATPase 16 kDa proteolipid subunit OS=Mus musculus GN=Atp6v0c PE=1 SV=1 7 158 6.0E-54
sp|O24011|VATL_SOLLC V-type proton ATPase 16 kDa proteolipid subunit OS=Solanum lycopersicum PE=2 SV=1 1 159 1.0E-52
sp|Q40585|VATL_TOBAC V-type proton ATPase 16 kDa proteolipid subunit OS=Nicotiana tabacum PE=2 SV=1 8 159 2.0E-52
sp|O22552|VATL_VIGRR V-type proton ATPase 16 kDa proteolipid subunit OS=Vigna radiata var. radiata PE=2 SV=1 1 159 2.0E-52
sp|P59229|VATL4_ARATH V-type proton ATPase subunit c4 OS=Arabidopsis thaliana GN=VHA-c4 PE=2 SV=1 8 159 3.0E-52
sp|P68162|VATL_BETVU V-type proton ATPase 16 kDa proteolipid subunit OS=Beta vulgaris GN=VMAC1 PE=2 SV=1 8 159 3.0E-52
sp|P68161|VATL_MESCR V-type proton ATPase 16 kDa proteolipid subunit OS=Mesembryanthemum crystallinum GN=VMAC1 PE=2 SV=1 8 159 3.0E-52
sp|P0DH92|VATL1_ARATH V-type proton ATPase subunit c1 OS=Arabidopsis thaliana GN=VHA-c1 PE=2 SV=1 8 159 3.0E-52
sp|P0DH93|VATL3_ARATH V-type proton ATPase subunit c3 OS=Arabidopsis thaliana GN=VHA-c3 PE=1 SV=1 8 159 3.0E-52
sp|Q96473|VATL_KALDA V-type proton ATPase 16 kDa proteolipid subunit OS=Kalanchoe daigremontiana PE=2 SV=1 8 159 3.0E-52
sp|P59228|VATL2_ARATH V-type proton ATPase subunit c2 OS=Arabidopsis thaliana GN=VHA-c2 PE=2 SV=1 8 159 3.0E-52
sp|Q43434|VATL_GOSHI V-type proton ATPase 16 kDa proteolipid subunit OS=Gossypium hirsutum GN=CVA16-2 PE=2 SV=1 8 159 3.0E-52
sp|P0DH94|VATL5_ARATH V-type proton ATPase subunit c5 OS=Arabidopsis thaliana GN=VHA-c5 PE=2 SV=1 8 159 3.0E-52
sp|P23957|VATL_AVESA V-type proton ATPase 16 kDa proteolipid subunit OS=Avena sativa GN=VATP-P1 PE=2 SV=1 10 159 1.0E-51
sp|Q0IUB5|VATL_ORYSJ V-type proton ATPase 16 kDa proteolipid subunit OS=Oryza sativa subsp. japonica GN=VATP-P1 PE=2 SV=1 8 159 4.0E-51
sp|A2ZBW5|VATL_ORYSI V-type proton ATPase 16 kDa proteolipid subunit OS=Oryza sativa subsp. indica GN=VATP-P1 PE=2 SV=1 8 159 4.0E-51
sp|P34546|VATL2_CAEEL V-type proton ATPase 16 kDa proteolipid subunit 2/3 OS=Caenorhabditis elegans GN=vha-2 PE=2 SV=2 1 157 2.0E-48
sp|Q612A5|VATL2_CAEBR V-type proton ATPase 16 kDa proteolipid subunit 2/3 OS=Caenorhabditis briggsae GN=vha-2 PE=3 SV=1 1 157 3.0E-48
sp|Q17046|VATL_ASCSU V-type proton ATPase 16 kDa proteolipid subunit OS=Ascaris suum GN=12 PE=3 SV=1 9 157 4.0E-48
sp|P54642|VATL_DICDI V-type proton ATPase proteolipid subunit OS=Dictyostelium discoideum GN=vatP PE=2 SV=1 3 160 2.0E-47
sp|Q21898|VATL1_CAEEL V-type proton ATPase 16 kDa proteolipid subunit 1 OS=Caenorhabditis elegans GN=vha-1 PE=2 SV=1 1 157 4.0E-43
sp|Q24810|VATL_ENTHI V-type proton ATPase 16 kDa proteolipid subunit OS=Entamoeba histolytica GN=VMA3 PE=3 SV=1 3 161 3.0E-38
sp|Q24808|VATL_ENTDI V-type proton ATPase 16 kDa proteolipid subunit OS=Entamoeba dispar GN=VMA3 PE=2 SV=1 3 155 6.0E-38
sp|Q41773|VATL_MAIZE V-type proton ATPase 16 kDa proteolipid subunit (Fragment) OS=Zea mays PE=2 SV=2 56 159 5.0E-31
sp|O14046|VATO_SCHPO Probable V-type proton ATPase 20 kDa proteolipid subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma16 PE=3 SV=1 14 160 6.0E-21
sp|Q99437|VATO_HUMAN V-type proton ATPase 21 kDa proteolipid subunit OS=Homo sapiens GN=ATP6V0B PE=2 SV=1 17 160 1.0E-15
sp|Q2TA24|VATO_BOVIN V-type proton ATPase 21 kDa proteolipid subunit OS=Bos taurus GN=ATP6V0B PE=2 SV=1 17 160 2.0E-15
sp|Q9SLA2|VATO2_ARATH V-type proton ATPase subunit c''2 OS=Arabidopsis thaliana GN=VHA-c''2 PE=1 SV=1 8 160 2.0E-15
sp|Q9SZY7|VATO1_ARATH V-type proton ATPase subunit c''1 OS=Arabidopsis thaliana GN=VHA-c''1 PE=1 SV=1 8 160 2.0E-15
sp|Q91V37|VATO_MOUSE V-type proton ATPase 21 kDa proteolipid subunit OS=Mus musculus GN=Atp6v0b PE=1 SV=1 17 160 2.0E-15
sp|P23968|VATO_YEAST V-type proton ATPase subunit c'' OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA16 PE=1 SV=1 17 144 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0015078 proton transmembrane transporter activity Yes
GO:1902600 proton transmembrane transport Yes
GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain Yes
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0008150 biological_process No
GO:0098655 cation transmembrane transport No
GO:0032991 protein-containing complex No
GO:0051234 establishment of localization No
GO:0098662 inorganic cation transmembrane transport No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0034220 ion transmembrane transport No
GO:0005215 transporter activity No
GO:0055085 transmembrane transport No
GO:0098796 membrane protein complex No
GO:0015075 ion transmembrane transporter activity No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0008324 cation transmembrane transporter activity No
GO:0098660 inorganic ion transmembrane transport No
GO:0006811 ion transport No
GO:0006812 cation transport No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 53 75 22
3 95 117 22
4 130 152 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 129.90 65.70 194.10
CcL In ants, during behavior modification 206.21 111.08 301.34
CcD In ants, recently dead 174.36 93.21 255.50

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.048506 yes
SC16a CcD 0.227678 no
CcL CcD 0.498737 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4118
MESELAPKFAPFIGMAGIAAAMVFGSIGAAYGTAKSGIGIAGVGTFRPDLIMKCLIPVVMSGIIAVYSLVISVLI
AQDLSPPGNESYALFSGFMHLACGTAVGMTGLAAGYCIGIVGDSGVRAFMQQSRIFVGMVLILIFGEVLGLYGLI
VALLLNSRSKG
Coding >Ophio5|4118
ATGGAGTCAGAGCTGGCACCCAAGTTTGCTCCCTTTATAGGCATGGCTGGCATAGCGGCCGCCATGGTCTTTGGC
TCCATCGGCGCCGCGTACGGCACCGCAAAGTCCGGCATCGGCATCGCGGGCGTCGGCACCTTCCGCCCGGACCTG
ATCATGAAGTGCCTGATCCCCGTCGTCATGTCGGGTATCATCGCCGTCTACTCGCTCGTCATCTCCGTCCTCATC
GCTCAAGACCTGTCACCGCCAGGTAACGAAAGCTACGCCCTTTTCTCGGGATTCATGCACCTCGCGTGTGGCACC
GCCGTCGGGATGACGGGCCTGGCGGCTGGATACTGCATCGGCATCGTCGGTGACTCGGGCGTGCGCGCCTTCATG
CAGCAGTCGCGGATCTTTGTCGGCATGGTTCTGATCCTCATCTTTGGCGAGGTCTTGGGTCTCTACGGTCTTATT
GTTGCACTACTTCTCAACTCGCGGAGCAAAGGC
Transcript >Ophio5|4118
ATGGAGTCAGAGCTGGCACCCAAGTTTGCTCCCTTTATAGGCATGGCTGGCATAGCGGCCGCCATGGTCTTTGGC
TCCATCGGCGCCGCGTACGGCACCGCAAAGTCCGGCATCGGCATCGCGGGCGTCGGCACCTTCCGCCCGGACCTG
ATCATGAAGTGCCTGATCCCCGTCGTCATGTCGGGTATCATCGCCGTCTACTCGCTCGTCATCTCCGTCCTCATC
GCTCAAGACCTGTCACCGCCAGGTAACGAAAGCTACGCCCTTTTCTCGGGATTCATGCACCTCGCGTGTGGCACC
GCCGTCGGGATGACGGGCCTGGCGGCTGGATACTGCATCGGCATCGTCGGTGACTCGGGCGTGCGCGCCTTCATG
CAGCAGTCGCGGATCTTTGTCGGCATGGTTCTGATCCTCATCTTTGGCGAGGTCTTGGGTCTCTACGGTCTTATT
GTTGCACTACTTCTCAACTCGCGGAGCAAAGGCTGA
Gene >Ophio5|4118
ATGGAGTCAGAGCTGGCACCCAAGTTTGCTCCCTTTATAGGCATGGTATGTTGTCTGTTGGCCACTGATACGAAC
GTTACCCGGGCTGATGCGTCGCCACAGGCTGGCATAGCGGCCGCCATGGTCTTTGGCTGTGAGCCTACTCCTTAC
CGTTCCCTCGCCGGCATGCGAAGAAGCTGACGGGCTACAGCCATCGGCGCCGCGTACGGCACCGCAAAGTCCGGC
ATCGGCATCGCGGGCGTCGGCACCTTCCGCCCGGACCTGATCATGAAGGTAGCGCCACGCCGGTTCGTCGATTGC
GCTCTTCTCCGCTGACGCCATGACCGTCAGTGCCTGATCCCCGTCGTCATGTCGGGTATCATCGCCGTCTACTCG
CTCGTCATCTCCGTCCTCATCGCTCAAGACCTGTCACCGCCAGGTAACGAAAGCTACGCCCTTTTCTCGTACGTC
CCTCCGAGAGTCAAATATACGTGGAGGTGATTTGACACCTTACAGGGGATTCATGCACCTCGCGTGTGGCACCGC
CGTCGGGATGACGGGCCTGGCGGCTGGATACTGCATCGGCATCGTCGGTGACTCGGGCGTGCGCGCCTTCATGCA
GCAGTCGCGGATCTTTGTCGGCATGGTTCTGATCCTCATCTTTGGCGAGGTCTTGGGTCTCTACGGGTAAGTCTG
GGCTGGTACGTGCTGGCGAGGAGGTTGCTGACGGTTTCAGTCTTATTGTTGCACTACTTCTCAACTCGCGGAGCA
AAGGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail