Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4115
Gene name
Locationscaffold_322:8104..9950
Strand-
Gene length (bp)1846
Transcript length (bp)1677
Coding sequence length (bp)1674
Protein length (aa) 558

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02133 Transp_cyt_pur Permease for cytosine/purines, uracil, thiamine, allantoin 7.2E-147 36 488

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14035|YEME_SCHPO Uncharacterized permease C29B12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC29B12.14c PE=3 SV=2 14 550 0.0E+00
sp|Q10279|FUR4_SCHPO Uracil permease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fur4 PE=1 SV=2 12 546 0.0E+00
sp|P38196|FUI1_YEAST Uridine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUI1 PE=1 SV=1 16 507 9.0E-152
sp|Q04895|DAL4_YEAST Allantoin permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL4 PE=1 SV=1 17 508 1.0E-151
sp|P05316|FUR4_YEAST Uracil permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUR4 PE=3 SV=2 17 544 3.0E-148
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14035|YEME_SCHPO Uncharacterized permease C29B12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC29B12.14c PE=3 SV=2 14 550 0.0E+00
sp|Q10279|FUR4_SCHPO Uracil permease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fur4 PE=1 SV=2 12 546 0.0E+00
sp|P38196|FUI1_YEAST Uridine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUI1 PE=1 SV=1 16 507 9.0E-152
sp|Q04895|DAL4_YEAST Allantoin permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL4 PE=1 SV=1 17 508 1.0E-151
sp|P05316|FUR4_YEAST Uracil permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUR4 PE=3 SV=2 17 544 3.0E-148
sp|P94575|ALLP_BACSU Probable allantoin permease OS=Bacillus subtilis (strain 168) GN=pucI PE=2 SV=1 29 520 5.0E-71
sp|Q9LZD0|NCS1_ARATH Purine-uracil permease NCS1 OS=Arabidopsis thaliana GN=NCS1 PE=1 SV=1 29 499 1.0E-68
sp|Q9P6J5|YHD5_SCHPO Uncharacterized permease C1683.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.05 PE=3 SV=1 3 508 5.0E-63
sp|Q08485|NRT1_YEAST Nicotinamide riboside transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NRT1 PE=1 SV=1 29 549 6.0E-56
sp|Q08579|THI72_YEAST Thiamine transporter THI72 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI72 PE=2 SV=1 1 548 4.0E-53
sp|Q05998|THI7_YEAST Thiamine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI7 PE=1 SV=1 1 548 4.0E-51
sp|P75712|ALLP_ECOLI Putative allantoin permease OS=Escherichia coli (strain K12) GN=ybbW PE=1 SV=2 31 501 4.0E-37
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 76 98 22
3 129 151 22
4 171 193 22
5 200 222 22
6 277 299 22
7 331 350 19
8 370 392 22
9 399 421 22
10 448 470 22
11 477 499 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4115
MAVKTRFSRWVDKLAVESVPDLSSKQLMLNNHDLKPVERRRRQWGTWNFVGFWVADSFNINTWMISSSMIMAGLS
WWQAWICIWVGYFISAALIVSTGRIGAVYHIGFPVANRASFGIWGSLWPVFNRAVMACVWYGLQSYIGGQVVYLM
IRAMSKSWDRARMPGPFDPTVTSTPEFVSYVIFWLCSLPALWFPVQKIRHLFTVKAYVVPPAAIAFLAWAAVRAG
GVGPILRQPSSISGSKLAWEMVRGIMSSIANFSTLIVNDCDFTRFARRPVDALWSQLLGIPLCFAMTSFIGIVVS
SSSTVIYGESIWNPVDLLGRFLDDGGGAQRFGVFVIAFALALAQLGTNIAANSVSAGSDLTALLPRYINIRRGGY
LCAVVGLAMCPYNLLASANRFTTYLSAYSVFLSSIAGVIITDYYLVRRGFLDVGELYDARRTGIYFYTWGVNYRA
YVAYIAGILVNVVGFAGAVGRQVPEAAIFLYRLDFFCGLFVSSAVYWALCRLHPVSGTSAHWMEVCEATEDSDSM
EEGSGGESGEGGHERGREQDDGEAGLQEGKSYK
Coding >Ophio5|4115
ATGGCTGTCAAGACTCGATTCAGTCGCTGGGTCGACAAGTTGGCCGTTGAGTCGGTGCCGGACCTTTCGTCCAAA
CAGCTCATGCTCAACAATCATGACCTCAAGCCAGTTGAGCGACGTCGTCGTCAATGGGGGACGTGGAACTTTGTG
GGCTTCTGGGTGGCTGACTCGTTTAACATCAACACCTGGATGATCTCGTCGTCGATGATCATGGCTGGTCTGTCG
TGGTGGCAGGCCTGGATCTGCATCTGGGTTGGATATTTCATCTCCGCCGCCTTGATCGTCTCGACCGGCAGGATC
GGAGCCGTCTATCACATTGGCTTCCCCGTCGCCAACCGCGCCTCGTTTGGCATATGGGGAAGTCTGTGGCCTGTC
TTCAACCGTGCCGTTATGGCTTGCGTGTGGTATGGGTTGCAGAGCTATATCGGAGGCCAGGTAGTCTACCTGATG
ATACGCGCCATGTCCAAGTCGTGGGACCGGGCGCGAATGCCGGGCCCTTTCGATCCCACCGTCACCAGCACGCCC
GAGTTCGTCTCCTATGTCATATTCTGGCTCTGCTCCTTGCCGGCCCTCTGGTTTCCCGTCCAGAAGATCCGCCAC
CTCTTCACCGTCAAGGCATATGTCGTACCCCCCGCCGCCATCGCCTTCCTGGCCTGGGCGGCCGTCCGAGCCGGT
GGCGTCGGGCCCATTCTCCGACAGCCGAGCTCGATTAGCGGTAGCAAGTTGGCGTGGGAGATGGTTCGGGGAATC
ATGTCGTCTATTGCCAACTTTTCGACCCTCATAGTCAATGACTGTGACTTCACGCGCTTTGCACGCAGACCGGTT
GACGCCTTGTGGTCGCAGCTGCTGGGCATACCTCTGTGCTTCGCCATGACCTCTTTCATCGGCATCGTCGTGTCT
TCGTCGTCGACTGTCATCTATGGCGAGTCCATCTGGAACCCTGTTGACCTCTTGGGCCGCTTTCTCGATGACGGC
GGCGGCGCCCAGCGCTTTGGCGTCTTCGTCATCGCTTTCGCTTTGGCCCTCGCGCAGCTCGGCACCAACATCGCG
GCCAACTCGGTCTCGGCCGGCTCCGACCTGACGGCACTGCTGCCGCGCTACATCAACATCCGCCGCGGTGGCTAC
TTGTGTGCCGTTGTCGGCCTGGCCATGTGTCCCTACAACCTCTTGGCCAGCGCCAATCGCTTCACCACCTACCTG
TCGGCCTACAGCGTCTTCCTCAGCTCCATCGCCGGCGTCATCATCACCGACTACTACCTCGTCCGTAGGGGCTTT
CTTGACGTTGGGGAGCTATACGACGCCCGTCGCACGGGTATCTACTTTTATACCTGGGGCGTCAATTACCGCGCC
TACGTCGCCTACATCGCCGGCATCCTCGTCAACGTCGTCGGCTTCGCTGGTGCCGTCGGTCGCCAGGTTCCCGAG
GCTGCTATCTTCCTCTACCGTTTGGATTTCTTCTGCGGCCTGTTTGTGTCGTCCGCTGTTTATTGGGCGCTCTGT
CGCCTGCATCCTGTGTCGGGAACGAGCGCGCATTGGATGGAGGTATGCGAGGCCACAGAAGATAGTGATTCTATG
GAAGAGGGGAGTGGCGGCGAATCGGGTGAGGGGGGTCATGAAAGGGGGCGAGAACAGGACGACGGAGAAGCAGGT
CTTCAGGAGGGAAAGTCGTACAAG
Transcript >Ophio5|4115
ATGGCTGTCAAGACTCGATTCAGTCGCTGGGTCGACAAGTTGGCCGTTGAGTCGGTGCCGGACCTTTCGTCCAAA
CAGCTCATGCTCAACAATCATGACCTCAAGCCAGTTGAGCGACGTCGTCGTCAATGGGGGACGTGGAACTTTGTG
GGCTTCTGGGTGGCTGACTCGTTTAACATCAACACCTGGATGATCTCGTCGTCGATGATCATGGCTGGTCTGTCG
TGGTGGCAGGCCTGGATCTGCATCTGGGTTGGATATTTCATCTCCGCCGCCTTGATCGTCTCGACCGGCAGGATC
GGAGCCGTCTATCACATTGGCTTCCCCGTCGCCAACCGCGCCTCGTTTGGCATATGGGGAAGTCTGTGGCCTGTC
TTCAACCGTGCCGTTATGGCTTGCGTGTGGTATGGGTTGCAGAGCTATATCGGAGGCCAGGTAGTCTACCTGATG
ATACGCGCCATGTCCAAGTCGTGGGACCGGGCGCGAATGCCGGGCCCTTTCGATCCCACCGTCACCAGCACGCCC
GAGTTCGTCTCCTATGTCATATTCTGGCTCTGCTCCTTGCCGGCCCTCTGGTTTCCCGTCCAGAAGATCCGCCAC
CTCTTCACCGTCAAGGCATATGTCGTACCCCCCGCCGCCATCGCCTTCCTGGCCTGGGCGGCCGTCCGAGCCGGT
GGCGTCGGGCCCATTCTCCGACAGCCGAGCTCGATTAGCGGTAGCAAGTTGGCGTGGGAGATGGTTCGGGGAATC
ATGTCGTCTATTGCCAACTTTTCGACCCTCATAGTCAATGACTGTGACTTCACGCGCTTTGCACGCAGACCGGTT
GACGCCTTGTGGTCGCAGCTGCTGGGCATACCTCTGTGCTTCGCCATGACCTCTTTCATCGGCATCGTCGTGTCT
TCGTCGTCGACTGTCATCTATGGCGAGTCCATCTGGAACCCTGTTGACCTCTTGGGCCGCTTTCTCGATGACGGC
GGCGGCGCCCAGCGCTTTGGCGTCTTCGTCATCGCTTTCGCTTTGGCCCTCGCGCAGCTCGGCACCAACATCGCG
GCCAACTCGGTCTCGGCCGGCTCCGACCTGACGGCACTGCTGCCGCGCTACATCAACATCCGCCGCGGTGGCTAC
TTGTGTGCCGTTGTCGGCCTGGCCATGTGTCCCTACAACCTCTTGGCCAGCGCCAATCGCTTCACCACCTACCTG
TCGGCCTACAGCGTCTTCCTCAGCTCCATCGCCGGCGTCATCATCACCGACTACTACCTCGTCCGTAGGGGCTTT
CTTGACGTTGGGGAGCTATACGACGCCCGTCGCACGGGTATCTACTTTTATACCTGGGGCGTCAATTACCGCGCC
TACGTCGCCTACATCGCCGGCATCCTCGTCAACGTCGTCGGCTTCGCTGGTGCCGTCGGTCGCCAGGTTCCCGAG
GCTGCTATCTTCCTCTACCGTTTGGATTTCTTCTGCGGCCTGTTTGTGTCGTCCGCTGTTTATTGGGCGCTCTGT
CGCCTGCATCCTGTGTCGGGAACGAGCGCGCATTGGATGGAGGTATGCGAGGCCACAGAAGATAGTGATTCTATG
GAAGAGGGGAGTGGCGGCGAATCGGGTGAGGGGGGTCATGAAAGGGGGCGAGAACAGGACGACGGAGAAGCAGGT
CTTCAGGAGGGAAAGTCGTACAAGTGA
Gene >Ophio5|4115
ATGGCTGTCAAGACTCGATTCAGTCGCTGGGTCGACAAGTTGGCCGTTGAGTCGGTGCCGGACCTTTCGTCCAAA
CAGCTCATGGTCCGCGGCCGTGTCTCCCATGCTCGTCGACTTCAGCTGACGCGCCGCCTGGGCAGCTCAACAATC
ATGACCTCAAGCCAGTTGAGCGACGTCGTCGTCAATGGGGGACGTGGAACTTTGTGGGCTTCTGGGTGGCTGACT
CGTTTAACATCAACACCTGGATGATCTCGTCGTCGATGATCATGGCTGGTCTGTCGTGGTGGCAGGCCTGGATCT
GCATCTGGGTTGGATATTTCATCTCCGCCGCCTTGATCGTCTCGACCGGCAGGATCGGAGCCGTCTATCACATTG
GCTTCCCCGTCGCCAACCGCGCCTCGTTTGGCATATGGGGAAGTCTGTGGCCTGTCTTCAACCGTGCCGTTATGG
GTGAGCACCTCTGGGAGCCGCCATGAAGCCGCTTGATTTGGGCTGACGACGCGACTTCACGTAGCTTGCGTGTGG
TAAGCGCGGCTCGCGTCGCCCCCGGGAGGTCGGTAGCTAAGGAAGCAGGTATGGGTTGCAGAGCTATATCGGAGG
CCAGGTAGTCTACCTGATGATACGCGCCATGTCCAAGTCGTGGGACCGGGCGCGAATGCCGGGCCCTTTCGATCC
CACCGTCACCAGCACGCCCGAGTTCGTCTCCTATGTCATATTCTGGCTCTGCTCCTTGCCGGCCCTCTGGTTTCC
CGTCCAGAAGATCCGCCACCTCTTCACCGTCAAGGCATATGTCGTACCCCCCGCCGCCATCGCCTTCCTGGCCTG
GGCGGCCGTCCGAGCCGGTGGCGTCGGGCCCATTCTCCGACAGCCGAGCTCGATTAGCGGTAGCAAGTTGGCGTG
GGAGATGGTTCGGGGAATCATGTCGTCTATTGCCAACTTTTCGACCCTCATAGTCAATGACTGTGACTTCACGCG
CTTTGCACGCAGACCGGTTGACGCCTTGTGGTCGCAGCTGCTGGGCATACCTCTGTGCTTCGCCATGACCTCTTT
CATCGGCATCGTCGTGTCTTCGTCGTCGACTGTCATCTATGGCGAGTCCATCTGGAACCCTGTTGACCTCTTGGG
CCGCTTTCTCGATGACGGCGGCGGCGCCCAGCGCTTTGGCGTCTTCGTCATCGCTTTCGCTTTGGCCCTCGCGCA
GCTCGGCACCAACATCGCGGCCAACTCGGTCTCGGCCGGCTCCGACCTGACGGCACTGCTGCCGCGCTACATCAA
CATCCGCCGCGGTGGCTACTTGTGTGCCGTTGTCGGCCTGGCCATGTGTCCCTACAACCTCTTGGCCAGCGCCAA
TCGCTTCACCACCTACCTGTCGGCCTACAGCGTCTTCCTCAGCTCCATCGCCGGCGTCATCATCACCGACTACTA
CCTCGTCCGTAGGGGCTTTCTTGACGTTGGGGAGCTATACGACGCCCGTCGCACGGGTATCTACTTTTATACCTG
GGGCGTCAATTACCGCGCCTACGTCGCCTACATCGCCGGCATCCTCGTCAACGTCGTCGGCTTCGCTGGTGCCGT
CGGTCGCCAGGTTCCCGAGGCTGCTATCTTCCTCTACCGTTTGGATTTCTTCTGCGGCCTGTTTGTGTCGTCCGC
TGTTTATTGGGCGCTCTGTCGCCTGCATCCTGTGTCGGGAACGAGCGCGCATTGGATGGAGGTATGCGAGGCCAC
AGAAGATAGTGATTCTATGGAAGAGGGGAGTGGCGGCGAATCGGGTGAGGGGGGTCATGAAAGGGGGCGAGAACA
GGACGACGGAGAAGCAGGTCTTCAGGAGGGAAAGTCGTACAAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail