Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4113
Gene name
Locationscaffold_322:1842..2966
Strand+
Gene length (bp)1124
Transcript length (bp)1071
Coding sequence length (bp)1068
Protein length (aa) 356

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11566 PI31_Prot_N PI31 proteasome regulator N-terminal 3.5E-22 38 190
PF08577 PI31_Prot_C PI31 proteasome regulator 8.3E-14 265 327

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.6209 0.71 0.1346 0.0285 0.2846 0.0084 0.2283 0.1572 0.0594 0.0599

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6059
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|50
Ophiocordyceps australis map64 (Brazil) OphauB2|5913
Ophiocordyceps camponoti-floridani Ophcf2|03083
Ophiocordyceps kimflemingae Ophio5|4113 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2225

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4113
MAPAHSASSLLSRMAASLPPSPTTSSSSSSSSSSSSSSPAISQPLQLVALLAHASLVSDGFVLRPLDASEDGPIS
SQSRSLPSDWATGSSGAISFVYESPPFTLRIDRLGSQIDVRAFVEGTDRILRLERSVADLVRQDGLPVRVPDDGE
NRLQELASKLQRAFVSDQAILNFARDLHLSITQELSPDRQQPSSLLETQHQSPQLDRRGRRSDKENDDFAPPAAR
VNLPPSSSTDDFPPPGFDDELDLNRARRLVLPDGRSPFNIGHDDLYPPGLGPRDPLRPSFGPAGMQPTFDDPLFG
PRPGPGPGPDGLDPQLPPGARWDPVGPGGGPRFPPPGSGHPFGPGGNFFGGGGGII
Coding >Ophio5|4113
ATGGCTCCCGCCCACAGCGCCTCCTCCCTGCTCTCCCGCATGGCCGCCTCTCTCCCTCCATCACCAACGACATCA
TCATCATCATCATCGTCATCGTCGTCATCATCATCATCCCCCGCCATCAGTCAACCTCTCCAACTCGTCGCTCTA
CTCGCGCACGCCTCCCTCGTATCCGATGGCTTCGTCCTGCGCCCTCTCGACGCCTCCGAAGACGGTCCCATCAGC
TCGCAAAGTCGTAGCCTTCCCTCGGACTGGGCTACTGGCTCCTCCGGCGCCATCTCTTTCGTTTACGAATCACCG
CCCTTCACTCTTCGTATCGATCGTCTCGGTTCGCAGATTGATGTCCGAGCTTTTGTTGAGGGCACCGATCGTATC
CTTCGTCTTGAACGCTCTGTTGCAGACCTCGTTCGACAGGATGGGCTCCCCGTTCGCGTCCCCGACGATGGCGAG
AATCGTCTTCAAGAGCTGGCCTCGAAGCTGCAGCGTGCCTTTGTCTCGGACCAGGCCATCCTCAACTTCGCTCGC
GACCTCCACCTCTCCATCACCCAAGAGCTCTCCCCAGACCGTCAACAACCCTCCTCCCTCCTCGAAACACAACAC
CAATCCCCTCAACTTGACCGTCGAGGCCGCCGAAGCGACAAGGAAAACGACGACTTCGCCCCCCCCGCCGCCAGA
GTCAACCTGCCTCCTTCCTCCTCAACCGACGATTTCCCCCCTCCCGGTTTCGACGACGAGCTGGACTTGAACCGC
GCCCGACGCCTCGTCCTCCCCGACGGCCGCTCCCCCTTCAACATCGGTCACGACGACCTATACCCCCCCGGTCTC
GGACCTCGCGATCCCCTTCGTCCCTCTTTCGGCCCCGCTGGCATGCAGCCCACTTTTGACGATCCCCTATTCGGG
CCTCGTCCCGGCCCCGGCCCCGGCCCCGACGGTCTCGATCCTCAGCTTCCGCCCGGAGCGCGCTGGGATCCCGTC
GGCCCCGGTGGCGGTCCTCGCTTCCCACCCCCCGGCAGTGGCCATCCGTTCGGGCCGGGAGGCAATTTCTTTGGT
GGCGGTGGCGGCATCATC
Transcript >Ophio5|4113
ATGGCTCCCGCCCACAGCGCCTCCTCCCTGCTCTCCCGCATGGCCGCCTCTCTCCCTCCATCACCAACGACATCA
TCATCATCATCATCGTCATCGTCGTCATCATCATCATCCCCCGCCATCAGTCAACCTCTCCAACTCGTCGCTCTA
CTCGCGCACGCCTCCCTCGTATCCGATGGCTTCGTCCTGCGCCCTCTCGACGCCTCCGAAGACGGTCCCATCAGC
TCGCAAAGTCGTAGCCTTCCCTCGGACTGGGCTACTGGCTCCTCCGGCGCCATCTCTTTCGTTTACGAATCACCG
CCCTTCACTCTTCGTATCGATCGTCTCGGTTCGCAGATTGATGTCCGAGCTTTTGTTGAGGGCACCGATCGTATC
CTTCGTCTTGAACGCTCTGTTGCAGACCTCGTTCGACAGGATGGGCTCCCCGTTCGCGTCCCCGACGATGGCGAG
AATCGTCTTCAAGAGCTGGCCTCGAAGCTGCAGCGTGCCTTTGTCTCGGACCAGGCCATCCTCAACTTCGCTCGC
GACCTCCACCTCTCCATCACCCAAGAGCTCTCCCCAGACCGTCAACAACCCTCCTCCCTCCTCGAAACACAACAC
CAATCCCCTCAACTTGACCGTCGAGGCCGCCGAAGCGACAAGGAAAACGACGACTTCGCCCCCCCCGCCGCCAGA
GTCAACCTGCCTCCTTCCTCCTCAACCGACGATTTCCCCCCTCCCGGTTTCGACGACGAGCTGGACTTGAACCGC
GCCCGACGCCTCGTCCTCCCCGACGGCCGCTCCCCCTTCAACATCGGTCACGACGACCTATACCCCCCCGGTCTC
GGACCTCGCGATCCCCTTCGTCCCTCTTTCGGCCCCGCTGGCATGCAGCCCACTTTTGACGATCCCCTATTCGGG
CCTCGTCCCGGCCCCGGCCCCGGCCCCGACGGTCTCGATCCTCAGCTTCCGCCCGGAGCGCGCTGGGATCCCGTC
GGCCCCGGTGGCGGTCCTCGCTTCCCACCCCCCGGCAGTGGCCATCCGTTCGGGCCGGGAGGCAATTTCTTTGGT
GGCGGTGGCGGCATCATCTAG
Gene >Ophio5|4113
ATGGCTCCCGCCCACAGCGCCTCCTCCCTGCTCTCCCGCATGGCCGCCTCTCTCCCTCCATCACCAACGACATCA
TCATCATCATCATCGTCATCGTCGTCATCATCATCATCCCCCGCCATCAGTCAACCTCTCCAACTCGTCGCTCTA
CTCGCGCACGCCTCCCTCGTATCCGATGGCTTCGTCCTGCGCCCTCTCGACGCCTCCGAAGACGGTCCCATCAGC
TCGCAAAGTCGTAGCCTTCCCTCGGACTGGGCTACTGGCTCCTCCGGCGCCATCTCTTTCGTTTACGAATCACCG
CCCTTCACTCTTCGTATCGATCGTCTCGGTTCGCAGATTGATGTCCGAGCTTTTGTTGAGGGCACCGATCGTATC
CTTCGTCTTGAACGCTCTGTTGCAGACCTCGTTCGACAGGATGGGCTCCCCGTTCGCGTCCCCGACGATGGCGAG
AATCGTCTTCAAGAGCTGGCCTCGAAGCTGCAGCGTGCCTTTGTCTCGGACCAGGCCATCCTCAGTTCGTTCCAT
CTTCTTGTGTTCCGTGTCATCATCTTCTGATCGCCTTGGCAGACTTCGCTCGCGACCTCCACCTCTCCATCACCC
AAGAGCTCTCCCCAGACCGTCAACAACCCTCCTCCCTCCTCGAAACACAACACCAATCCCCTCAACTTGACCGTC
GAGGCCGCCGAAGCGACAAGGAAAACGACGACTTCGCCCCCCCCGCCGCCAGAGTCAACCTGCCTCCTTCCTCCT
CAACCGACGATTTCCCCCCTCCCGGTTTCGACGACGAGCTGGACTTGAACCGCGCCCGACGCCTCGTCCTCCCCG
ACGGCCGCTCCCCCTTCAACATCGGTCACGACGACCTATACCCCCCCGGTCTCGGACCTCGCGATCCCCTTCGTC
CCTCTTTCGGCCCCGCTGGCATGCAGCCCACTTTTGACGATCCCCTATTCGGGCCTCGTCCCGGCCCCGGCCCCG
GCCCCGACGGTCTCGATCCTCAGCTTCCGCCCGGAGCGCGCTGGGATCCCGTCGGCCCCGGTGGCGGTCCTCGCT
TCCCACCCCCCGGCAGTGGCCATCCGTTCGGGCCGGGAGGCAATTTCTTTGGTGGCGGTGGCGGCATCATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail