Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4112
Gene name
Locationscaffold_322:738..1059
Strand+
Gene length (bp)321
Transcript length (bp)321
Coding sequence length (bp)318
Protein length (aa) 106

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0855 0.0713 0.9504 0.0845 0.0873 0.0053 0.0858 0.1033 0.1024 0.0019

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.999247

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 11.63 0.76 22.50
CcL In ants, during behavior modification 304.85 146.46 463.23
CcD In ants, recently dead 166.32 76.00 256.63

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.021588 yes

Orthologs

Orthofinder run ID4
Orthogroup15887
Change Orthofinder run
Species Protein ID
Ophiocordyceps kimflemingae Ophio5|4112 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4112
MRFTLTTTTIGLLLATNVMASCGSQAACEAKTGRARIGCLAHWKACSASTKTTKTEETYNNPCGGNFASEPPSNH
PLPDTLPHGCQYRTGVKVVVGSSSPTGAASD
Coding >Ophio5|4112
ATGCGATTCACACTCACAACCACCACCATCGGCCTACTGCTGGCCACCAACGTCATGGCCAGCTGCGGCAGTCAG
GCAGCGTGCGAGGCCAAGACGGGACGCGCACGTATCGGCTGTCTCGCTCATTGGAAGGCCTGCTCGGCGTCTACG
AAGACGACGAAGACGGAGGAGACGTACAATAACCCCTGCGGAGGCAATTTTGCTTCCGAGCCGCCTTCCAATCAC
CCTCTTCCCGATACCCTTCCTCACGGATGTCAGTATCGTACCGGTGTCAAGGTCGTCGTTGGCAGCAGCTCGCCG
ACCGGTGCTGCCTCCGAT
Transcript >Ophio5|4112
ATGCGATTCACACTCACAACCACCACCATCGGCCTACTGCTGGCCACCAACGTCATGGCCAGCTGCGGCAGTCAG
GCAGCGTGCGAGGCCAAGACGGGACGCGCACGTATCGGCTGTCTCGCTCATTGGAAGGCCTGCTCGGCGTCTACG
AAGACGACGAAGACGGAGGAGACGTACAATAACCCCTGCGGAGGCAATTTTGCTTCCGAGCCGCCTTCCAATCAC
CCTCTTCCCGATACCCTTCCTCACGGATGTCAGTATCGTACCGGTGTCAAGGTCGTCGTTGGCAGCAGCTCGCCG
ACCGGTGCTGCCTCCGATTGA
Gene >Ophio5|4112
ATGCGATTCACACTCACAACCACCACCATCGGCCTACTGCTGGCCACCAACGTCATGGCCAGCTGCGGCAGTCAG
GCAGCGTGCGAGGCCAAGACGGGACGCGCACGTATCGGCTGTCTCGCTCATTGGAAGGCCTGCTCGGCGTCTACG
AAGACGACGAAGACGGAGGAGACGTACAATAACCCCTGCGGAGGCAATTTTGCTTCCGAGCCGCCTTCCAATCAC
CCTCTTCCCGATACCCTTCCTCACGGATGTCAGTATCGTACCGGTGTCAAGGTCGTCGTTGGCAGCAGCTCGCCG
ACCGGTGCTGCCTCCGATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail