Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|411
Gene name
Locationscaffold_11:20244..22024
Strand+
Gene length (bp)1780
Transcript length (bp)1680
Coding sequence length (bp)1677
Protein length (aa) 559

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01896 DNA_primase_S DNA primase small subunit 1.6E-63 237 467

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14215|PRI1_SCHPO DNA primase small subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pri1 PE=1 SV=1 114 554 3.0E-163
sp|P20664|PRI1_MOUSE DNA primase small subunit OS=Mus musculus GN=Prim1 PE=1 SV=1 114 550 1.0E-111
sp|P10363|PRI1_YEAST DNA primase small subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRI1 PE=1 SV=2 108 555 3.0E-109
sp|P49642|PRI1_HUMAN DNA primase small subunit OS=Homo sapiens GN=PRIM1 PE=1 SV=1 117 550 1.0E-108
sp|Q24317|PRI1_DROME DNA primase small subunit OS=Drosophila melanogaster GN=DNApol-alpha50 PE=2 SV=2 109 549 2.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14215|PRI1_SCHPO DNA primase small subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pri1 PE=1 SV=1 114 554 3.0E-163
sp|P20664|PRI1_MOUSE DNA primase small subunit OS=Mus musculus GN=Prim1 PE=1 SV=1 114 550 1.0E-111
sp|P10363|PRI1_YEAST DNA primase small subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRI1 PE=1 SV=2 108 555 3.0E-109
sp|P49642|PRI1_HUMAN DNA primase small subunit OS=Homo sapiens GN=PRIM1 PE=1 SV=1 117 550 1.0E-108
sp|Q24317|PRI1_DROME DNA primase small subunit OS=Drosophila melanogaster GN=DNApol-alpha50 PE=2 SV=2 109 549 2.0E-92
sp|Q25998|PRI1_PLAFK DNA primase small subunit OS=Plasmodium falciparum (isolate K1 / Thailand) PE=3 SV=1 123 540 3.0E-74
sp|Q7KQM1|PRI1_PLAF7 DNA primase small subunit OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0366 PE=3 SV=1 123 540 3.0E-74
sp|P34471|PRI1_CAEEL DNA primase small subunit OS=Caenorhabditis elegans GN=pri-1 PE=3 SV=1 117 540 3.0E-61
[Show less]

GO

GO Term Description Terminal node
GO:0006269 DNA replication, synthesis of RNA primer Yes
GO:0003896 DNA primase activity Yes
GO:0009987 cellular process No
GO:0034062 5'-3' RNA polymerase activity No
GO:0043170 macromolecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0097747 RNA polymerase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0009058 biosynthetic process No
GO:0016779 nucleotidyltransferase activity No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0003899 DNA-directed 5'-3' RNA polymerase activity No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3378 0.8462 0.0489 0.0394 0.2192 0.0024 0.0841 0.0454 0.0209 0.0014

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5145
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7804
Ophiocordyceps australis map64 (Brazil) OphauB2|1835
Ophiocordyceps camponoti-rufipedis Ophun1|3209
Ophiocordyceps kimflemingae Ophio5|411 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3552

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|411
MPHSVEFPAIEAHEDDDQVMADDDGVAIEDEARREDVKLEEEEAVKEKSQEVEVAEIKDEKVSKTENVELEALLF
DDDDDDDDEFPSSAPAKAPSSSSPSSSRSKSPVSAPVKASDPEVMRSFYQRLFPWRQLFHWLNHGPTPTNDFANR
EFAFTLQNDAYLRYQSFATSDLLRSPYPFPPLSPKLFPSLSDLLRKDVLRLVPSRFEIGPVYSANPRDRKTLRGS
SAFKPVAKELCFDIDLTDYDDVRTCCDKANICKKCWAFITMAIHIVDVALRDDFGFAHILWVYSGRRGAHAWVCD
KKARALDDQKRRAIAGYLEVVRGGAHSGKKVNVRRPLHPHLSRSLDILKSHFQQDVLDAQDPWATTEQAEKLLQL
LPDRRLNDSLRRKWESSPGRNSASKWADIDAVAKTGASKSLDPRALLEAKQDVVLEYAYPRLDVEVSKKLNHLLK
SPFVVHPGTGRVCVPIDKSRLADFDPLGVPTVQELLAEIDAWREGEDKEDKEDNEEEGDGVAKGKGVADWEKTSL
KPYVDYFRSFVAGLVRDEKGARIKREREEDPMEF
Coding >Ophio5|411
ATGCCGCACTCAGTCGAGTTTCCTGCCATCGAGGCACACGAAGACGACGACCAAGTCATGGCCGACGACGATGGC
GTCGCCATCGAGGACGAGGCCAGGAGGGAAGACGTCAAGCTCGAAGAGGAGGAGGCGGTCAAGGAGAAATCCCAA
GAGGTTGAAGTCGCCGAGATCAAAGACGAAAAGGTGTCCAAGACTGAAAATGTCGAGCTCGAAGCGCTGCTCTTC
GACGACGACGACGACGACGACGACGAATTCCCCAGCTCCGCCCCAGCCAAAGCACCCTCCTCTTCCTCCCCTTCT
TCTTCTCGATCGAAATCCCCCGTCTCAGCCCCCGTCAAGGCATCAGACCCCGAAGTCATGAGGAGCTTTTACCAG
CGCCTCTTCCCCTGGCGTCAACTCTTCCATTGGCTGAATCACGGCCCTACGCCGACAAACGACTTTGCAAATCGC
GAATTTGCCTTTACCCTGCAGAATGACGCCTACTTGCGATACCAGTCCTTCGCTACCTCTGACCTGTTGCGTTCC
CCCTACCCTTTCCCTCCTCTTTCCCCGAAACTCTTTCCATCTCTCTCGGATTTGTTACGCAAGGATGTGTTACGC
CTCGTCCCCTCACGTTTCGAAATCGGACCGGTTTATTCGGCCAATCCCCGCGATCGAAAGACTCTGCGCGGCTCA
TCTGCTTTCAAACCGGTTGCCAAGGAACTTTGTTTCGACATCGACTTGACTGATTACGATGACGTGCGGACGTGC
TGTGATAAGGCGAATATATGCAAAAAGTGCTGGGCTTTCATCACAATGGCCATCCATATTGTGGATGTAGCTCTG
CGGGATGACTTTGGCTTCGCTCATATCCTCTGGGTCTACTCGGGTCGCAGAGGAGCTCACGCCTGGGTCTGCGAT
AAGAAGGCTCGCGCCTTGGACGATCAGAAAAGGAGGGCTATTGCTGGCTACCTTGAAGTCGTCAGGGGGGGCGCC
CACTCTGGCAAAAAGGTCAACGTCCGCCGTCCGCTGCATCCTCATCTCTCCCGCAGCCTCGACATCCTCAAGTCC
CACTTCCAGCAAGACGTCCTCGACGCCCAAGACCCCTGGGCGACGACCGAGCAAGCCGAGAAGCTCCTCCAACTT
CTCCCCGACCGCAGGCTAAACGACTCGCTGCGCCGCAAGTGGGAGTCATCGCCGGGCCGCAACTCGGCCTCCAAA
TGGGCCGACATCGACGCCGTGGCCAAGACGGGCGCCAGCAAGAGCCTTGACCCGCGCGCCCTTCTCGAAGCCAAG
CAGGATGTGGTGCTGGAGTACGCCTACCCGCGTCTCGACGTCGAAGTCAGCAAGAAGCTCAATCACTTGCTCAAG
AGCCCCTTTGTCGTCCATCCCGGCACCGGCCGCGTGTGCGTGCCCATCGACAAGTCCAGGCTGGCAGACTTTGAC
CCCTTGGGCGTGCCGACGGTGCAGGAGCTGCTGGCGGAAATTGATGCGTGGAGGGAGGGGGAGGACAAGGAGGAC
AAGGAGGACAATGAGGAGGAGGGCGACGGTGTGGCCAAGGGCAAGGGTGTCGCGGATTGGGAGAAGACGAGTCTC
AAGCCGTATGTTGACTACTTTAGATCTTTTGTGGCTGGCCTGGTGAGAGACGAGAAGGGGGCGAGGATCAAGCGG
GAGCGGGAAGAGGACCCGATGGAGTTT
Transcript >Ophio5|411
ATGCCGCACTCAGTCGAGTTTCCTGCCATCGAGGCACACGAAGACGACGACCAAGTCATGGCCGACGACGATGGC
GTCGCCATCGAGGACGAGGCCAGGAGGGAAGACGTCAAGCTCGAAGAGGAGGAGGCGGTCAAGGAGAAATCCCAA
GAGGTTGAAGTCGCCGAGATCAAAGACGAAAAGGTGTCCAAGACTGAAAATGTCGAGCTCGAAGCGCTGCTCTTC
GACGACGACGACGACGACGACGACGAATTCCCCAGCTCCGCCCCAGCCAAAGCACCCTCCTCTTCCTCCCCTTCT
TCTTCTCGATCGAAATCCCCCGTCTCAGCCCCCGTCAAGGCATCAGACCCCGAAGTCATGAGGAGCTTTTACCAG
CGCCTCTTCCCCTGGCGTCAACTCTTCCATTGGCTGAATCACGGCCCTACGCCGACAAACGACTTTGCAAATCGC
GAATTTGCCTTTACCCTGCAGAATGACGCCTACTTGCGATACCAGTCCTTCGCTACCTCTGACCTGTTGCGTTCC
CCCTACCCTTTCCCTCCTCTTTCCCCGAAACTCTTTCCATCTCTCTCGGATTTGTTACGCAAGGATGTGTTACGC
CTCGTCCCCTCACGTTTCGAAATCGGACCGGTTTATTCGGCCAATCCCCGCGATCGAAAGACTCTGCGCGGCTCA
TCTGCTTTCAAACCGGTTGCCAAGGAACTTTGTTTCGACATCGACTTGACTGATTACGATGACGTGCGGACGTGC
TGTGATAAGGCGAATATATGCAAAAAGTGCTGGGCTTTCATCACAATGGCCATCCATATTGTGGATGTAGCTCTG
CGGGATGACTTTGGCTTCGCTCATATCCTCTGGGTCTACTCGGGTCGCAGAGGAGCTCACGCCTGGGTCTGCGAT
AAGAAGGCTCGCGCCTTGGACGATCAGAAAAGGAGGGCTATTGCTGGCTACCTTGAAGTCGTCAGGGGGGGCGCC
CACTCTGGCAAAAAGGTCAACGTCCGCCGTCCGCTGCATCCTCATCTCTCCCGCAGCCTCGACATCCTCAAGTCC
CACTTCCAGCAAGACGTCCTCGACGCCCAAGACCCCTGGGCGACGACCGAGCAAGCCGAGAAGCTCCTCCAACTT
CTCCCCGACCGCAGGCTAAACGACTCGCTGCGCCGCAAGTGGGAGTCATCGCCGGGCCGCAACTCGGCCTCCAAA
TGGGCCGACATCGACGCCGTGGCCAAGACGGGCGCCAGCAAGAGCCTTGACCCGCGCGCCCTTCTCGAAGCCAAG
CAGGATGTGGTGCTGGAGTACGCCTACCCGCGTCTCGACGTCGAAGTCAGCAAGAAGCTCAATCACTTGCTCAAG
AGCCCCTTTGTCGTCCATCCCGGCACCGGCCGCGTGTGCGTGCCCATCGACAAGTCCAGGCTGGCAGACTTTGAC
CCCTTGGGCGTGCCGACGGTGCAGGAGCTGCTGGCGGAAATTGATGCGTGGAGGGAGGGGGAGGACAAGGAGGAC
AAGGAGGACAATGAGGAGGAGGGCGACGGTGTGGCCAAGGGCAAGGGTGTCGCGGATTGGGAGAAGACGAGTCTC
AAGCCGTATGTTGACTACTTTAGATCTTTTGTGGCTGGCCTGGTGAGAGACGAGAAGGGGGCGAGGATCAAGCGG
GAGCGGGAAGAGGACCCGATGGAGTTTTAA
Gene >Ophio5|411
ATGCCGCACTCAGTCGAGTTTCCTGCCATCGAGGCACACGAAGACGACGACCAAGTCATGGCCGACGACGATGGC
GTCGCCATCGAGGACGAGGCCAGGAGGGAAGACGTCAAGCTCGAAGAGGAGGAGGCGGTCAAGGAGAAATCCCAA
GAGGTTGAAGTCGCCGAGATCAAAGACGAAAAGGTGTCCAAGACTGAAAATGTCGAGCTCGAAGCGCTGCTCTTC
GACGACGACGACGACGACGACGACGAATTCCCCAGCTCCGCCCCAGCCAAAGCACCCTCCTCTTCCTCCCCTTCT
TCTTCTCGATCGAAATCCCCCGTCTCAGCCCCCGTCAAGGCATCAGACCCCGAAGTCATGAGGAGCTTTTACCAG
CGCCTCTTCCCCTGGCGTCAACTCTTCCATTGGCTGAATCACGGCCCTACGCCGACAAACGACTTTGCAAATCGC
GAATTTGCCTTTACCCTGCAGAATGACGCCTACTTGCGATACCAGTCCTTCGCTACCTCTGACCTGTTGCGTTCC
CCCTACCCTTTCCCTCCTCTTTCCCCGAAACTCTTTCCATCTCTCTCGGATTTGTTGGTTTGGCTGACGGGGGTG
AGGCCAAAAAAAAATCACCAGGTTACGCAAGGATGTGTTACGCCTCGTCCCCTCACGTTTCGAAATCGGACCGGT
TTATTCGGCCAATCCCCGCGATCGAAAGACTCTGCGCGGCTCATCTGCTTTCAAACCGGTTGCCAAGGAACTTTG
TTTCGACATCGACTTGACTGATTACGATGACGTGCGGACGTGCTGTGATAAGGCGAATATATGCAAAAAGTGCTG
GGCTTTCATCACAATGGCCATCCATATTGTGGATGTAGCTCTGCGGGATGACTTTGGCTTCGCTCATATCCTCTG
GGTCTACTCGGGTCGCAGAGGAGCTCACGCCTGGGTCTGCGATAAGAAGGCTCGCGCCTTGGACGATCAGAAAAG
GAGGGCTATTGCTGGCTACCTTGAAGTCGTCAGGGGGGGCGCCCACTCTGGCAAAAAGGTCAACGTCCGCCGTCC
GCTGCATCCTCATCTCTCGTACGTTTGTCCCCTCCCTTCCTGATATCCTGCTTGCTTGCTTACTTGGGCAAACAG
CCGCAGCCTCGACATCCTCAAGTCCCACTTCCAGCAAGACGTCCTCGACGCCCAAGACCCCTGGGCGACGACCGA
GCAAGCCGAGAAGCTCCTCCAACTTCTCCCCGACCGCAGGCTAAACGACTCGCTGCGCCGCAAGTGGGAGTCATC
GCCGGGCCGCAACTCGGCCTCCAAATGGGCCGACATCGACGCCGTGGCCAAGACGGGCGCCAGCAAGAGCCTTGA
CCCGCGCGCCCTTCTCGAAGCCAAGCAGGATGTGGTGCTGGAGTACGCCTACCCGCGTCTCGACGTCGAAGTCAG
CAAGAAGCTCAATCACTTGCTCAAGAGCCCCTTTGTCGTCCATCCCGGCACCGGCCGCGTGTGCGTGCCCATCGA
CAAGTCCAGGCTGGCAGACTTTGACCCCTTGGGCGTGCCGACGGTGCAGGAGCTGCTGGCGGAAATTGATGCGTG
GAGGGAGGGGGAGGACAAGGAGGACAAGGAGGACAATGAGGAGGAGGGCGACGGTGTGGCCAAGGGCAAGGGTGT
CGCGGATTGGGAGAAGACGAGTCTCAAGCCGTATGTTGACTACTTTAGATCTTTTGTGGCTGGCCTGGTGAGAGA
CGAGAAGGGGGCGAGGATCAAGCGGGAGCGGGAAGAGGACCCGATGGAGTTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail