Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4107
Gene name
Locationscaffold_321:13217..14431
Strand+
Gene length (bp)1214
Transcript length (bp)1158
Coding sequence length (bp)1155
Protein length (aa) 385

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07281 INSIG Insulin-induced protein (INSIG) 7.2E-79 147 370

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0CMA4|INSI2_CALJA Insulin-induced gene 2 protein OS=Callithrix jacchus GN=INSIG2 PE=3 SV=1 132 373 4.0E-08
sp|Q5R687|INSI2_PONAB Insulin-induced gene 2 protein OS=Pongo abelii GN=INSIG2 PE=2 SV=2 132 373 1.0E-07
sp|Q9Y5U4|INSI2_HUMAN Insulin-induced gene 2 protein OS=Homo sapiens GN=INSIG2 PE=1 SV=2 132 373 1.0E-07
sp|Q80UA9|INSI2_RAT Insulin-induced gene 2 protein OS=Rattus norvegicus GN=Insig2 PE=2 SV=1 132 373 2.0E-07
sp|P53898|NSG2_YEAST Protein NSG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSG2 PE=1 SV=1 60 296 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0CMA4|INSI2_CALJA Insulin-induced gene 2 protein OS=Callithrix jacchus GN=INSIG2 PE=3 SV=1 132 373 4.0E-08
sp|Q5R687|INSI2_PONAB Insulin-induced gene 2 protein OS=Pongo abelii GN=INSIG2 PE=2 SV=2 132 373 1.0E-07
sp|Q9Y5U4|INSI2_HUMAN Insulin-induced gene 2 protein OS=Homo sapiens GN=INSIG2 PE=1 SV=2 132 373 1.0E-07
sp|Q80UA9|INSI2_RAT Insulin-induced gene 2 protein OS=Rattus norvegicus GN=Insig2 PE=2 SV=1 132 373 2.0E-07
sp|P53898|NSG2_YEAST Protein NSG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSG2 PE=1 SV=1 60 296 3.0E-07
sp|Q91WG1|INSI2_MOUSE Insulin-induced gene 2 protein OS=Mus musculus GN=Insig2 PE=1 SV=1 132 373 3.0E-07
sp|A9RA88|INSI2_PAPAN Insulin-induced gene 2 protein OS=Papio anubis GN=INSIG2 PE=3 SV=1 132 373 3.0E-07
sp|Q6PQZ3|INSI2_PIG Insulin-induced gene 2 protein OS=Sus scrofa GN=INSIG2 PE=2 SV=2 132 373 3.0E-07
sp|Q66J27|INSI2_XENLA Insulin-induced gene 2 protein OS=Xenopus laevis GN=insig2 PE=2 SV=1 233 377 4.0E-06
sp|Q5U4Q2|INSI2_XENTR Insulin-induced gene 2 protein OS=Xenopus tropicalis GN=insig2 PE=2 SV=1 233 374 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 141 163 22
2 184 206 22
3 254 276 22
4 283 305 22
5 349 371 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4107
MPDEGPTILRPIPRRPFSLKLISATPPSEDDDAQLTDAGWQDPLAAGFLESDAASLSRQKSLMNLTSSTLMGIYS
QAASDGCDRSLVDRDDADTPWGTRAQTLARPQSLDDATYQLMRHRSNLPQRIAVNTPLPSPTSSSAFALSARVVL
LFLLGSGYGVLVTRLHGDERYRTHLTEGFVKPGLSCNYLACWGAFGAILGSLLPWFDKLWDDTLAAETDADEIPA
ESLGPGTDWALVMRAIGAFAGIVFAIRKLSWVSTLQISATLALANPLLWWLIDRSKVGLLLSAGVGVAGSVVLLS
VNPSMMPAPSRALPHALAGRNMSASSMVHGMPSAVLGGLASRETVETGIWMLSVLFNSCVCFGNIGRRLALNEKA
GVRGRWGGVR
Coding >Ophio5|4107
ATGCCCGACGAAGGCCCCACGATTCTGCGGCCTATCCCCCGACGACCTTTTAGCTTGAAACTCATCAGCGCCACG
CCTCCCTCCGAAGACGACGATGCGCAGTTGACGGATGCCGGCTGGCAAGACCCGTTAGCCGCTGGCTTCCTCGAG
TCCGATGCAGCTTCGCTCAGCCGTCAAAAGTCGTTGATGAATCTCACGTCGTCCACCCTCATGGGCATCTACTCG
CAGGCCGCGTCTGACGGCTGTGACCGCTCTTTGGTCGACCGCGATGACGCCGACACTCCCTGGGGTACGCGCGCC
CAGACGCTCGCAAGGCCACAGAGTCTCGACGACGCCACATACCAGCTGATGCGTCACCGCTCGAATTTGCCGCAG
CGGATAGCCGTCAACACGCCGCTGCCTTCGCCGACTTCGAGCTCTGCGTTTGCACTCAGTGCACGCGTTGTGCTC
CTCTTCCTCCTCGGTAGCGGCTATGGTGTCTTGGTGACCCGGCTTCACGGTGACGAGCGGTATCGCACACACCTG
ACCGAGGGCTTCGTCAAGCCGGGACTCAGCTGTAACTACCTCGCCTGCTGGGGCGCATTCGGCGCCATCCTCGGA
TCGCTGTTGCCCTGGTTCGACAAGCTATGGGACGACACCTTGGCGGCCGAGACAGACGCTGATGAGATTCCAGCA
GAGAGTCTCGGGCCGGGCACCGACTGGGCACTTGTCATGCGTGCCATCGGAGCGTTTGCCGGTATTGTCTTTGCC
ATTCGCAAGCTCTCGTGGGTCTCGACACTGCAAATCTCGGCCACGCTCGCCCTCGCCAATCCGCTGCTATGGTGG
CTGATTGACCGGAGCAAAGTCGGCCTGCTCCTTTCGGCGGGAGTGGGCGTGGCTGGATCGGTAGTGCTCCTCAGC
GTGAACCCGAGCATGATGCCCGCACCGAGCAGAGCACTGCCGCACGCATTGGCCGGGCGCAACATGTCAGCATCG
TCCATGGTGCACGGTATGCCCTCGGCCGTTCTGGGGGGGCTGGCCAGCCGAGAGACTGTCGAGACGGGCATATGG
ATGCTCAGCGTACTGTTCAACAGCTGCGTGTGTTTCGGAAACATTGGGAGGCGGTTGGCGTTGAACGAAAAGGCC
GGTGTCAGAGGGCGTTGGGGAGGCGTCCGA
Transcript >Ophio5|4107
ATGCCCGACGAAGGCCCCACGATTCTGCGGCCTATCCCCCGACGACCTTTTAGCTTGAAACTCATCAGCGCCACG
CCTCCCTCCGAAGACGACGATGCGCAGTTGACGGATGCCGGCTGGCAAGACCCGTTAGCCGCTGGCTTCCTCGAG
TCCGATGCAGCTTCGCTCAGCCGTCAAAAGTCGTTGATGAATCTCACGTCGTCCACCCTCATGGGCATCTACTCG
CAGGCCGCGTCTGACGGCTGTGACCGCTCTTTGGTCGACCGCGATGACGCCGACACTCCCTGGGGTACGCGCGCC
CAGACGCTCGCAAGGCCACAGAGTCTCGACGACGCCACATACCAGCTGATGCGTCACCGCTCGAATTTGCCGCAG
CGGATAGCCGTCAACACGCCGCTGCCTTCGCCGACTTCGAGCTCTGCGTTTGCACTCAGTGCACGCGTTGTGCTC
CTCTTCCTCCTCGGTAGCGGCTATGGTGTCTTGGTGACCCGGCTTCACGGTGACGAGCGGTATCGCACACACCTG
ACCGAGGGCTTCGTCAAGCCGGGACTCAGCTGTAACTACCTCGCCTGCTGGGGCGCATTCGGCGCCATCCTCGGA
TCGCTGTTGCCCTGGTTCGACAAGCTATGGGACGACACCTTGGCGGCCGAGACAGACGCTGATGAGATTCCAGCA
GAGAGTCTCGGGCCGGGCACCGACTGGGCACTTGTCATGCGTGCCATCGGAGCGTTTGCCGGTATTGTCTTTGCC
ATTCGCAAGCTCTCGTGGGTCTCGACACTGCAAATCTCGGCCACGCTCGCCCTCGCCAATCCGCTGCTATGGTGG
CTGATTGACCGGAGCAAAGTCGGCCTGCTCCTTTCGGCGGGAGTGGGCGTGGCTGGATCGGTAGTGCTCCTCAGC
GTGAACCCGAGCATGATGCCCGCACCGAGCAGAGCACTGCCGCACGCATTGGCCGGGCGCAACATGTCAGCATCG
TCCATGGTGCACGGTATGCCCTCGGCCGTTCTGGGGGGGCTGGCCAGCCGAGAGACTGTCGAGACGGGCATATGG
ATGCTCAGCGTACTGTTCAACAGCTGCGTGTGTTTCGGAAACATTGGGAGGCGGTTGGCGTTGAACGAAAAGGCC
GGTGTCAGAGGGCGTTGGGGAGGCGTCCGATGA
Gene >Ophio5|4107
ATGCCCGACGAAGGCCCCACGATTCTGCGGCCTATCCCCCGACGACCTTTTAGCTTGAAACTCATCAGCGCCACG
CCTCCCTCCGAAGACGACGATGCGCAGTTGACGGATGCCGGCTGGCAAGACCCGTTAGCCGCTGGCTTCCTCGAG
TCCGATGCAGCTTCGCTCAGCCGTCAAAAGTCGTTGATGAATCTCACGTCGTCCACCCTCATGGGCATCTACTCG
CAGGCCGCGTCTGACGGCTGTGACCGCTCTTTGGTCGACCGCGATGACGCCGACACTCCCTGGGGTACGCGCGCC
CAGACGCTCGCAAGGCCACAGAGTCTCGACGACGCCACATACCAGCTGATGCGTCACCGCTCGAATTTGCCGCAG
CGGATAGCCGTCAACACGCCGCTGCCTTCGCCGACTTCGAGCTCTGCGTTTGCACTCAGTGCACGCGTTGTGCTC
CTCTTCCTCCTCGGTAGCGGCTATGGTGTCTTGGTGACCCGGCTTCACGGTGACGAGCGGTATCGCACACACCTG
ACCGAGGGCTTCGTCAAGCCGGGACTCAGCTGTAACTACCTCGCCTGCTGGGGCGCATTCGGCGCCATCCTCGGA
TCGCTGTTGCCCTGGTTCGACAAGCTATGGGACGACACCTTGGCGGCCGAGACAGACGCTGATGAGATTCCAGCA
GAGAGTCTCGGGCCGGGCACCGACTGGGCACTTGTCATGCGTGCCATCGGAGCGTTTGCCGGTATTGTCTTTGCC
ATTGTAAGTCGTTCTCCGCGCGCTTGGGAGACGCGACGCTGACGCAGCAATGGATTCAGCGCAAGCTCTCGTGGG
TCTCGACACTGCAAATCTCGGCCACGCTCGCCCTCGCCAATCCGCTGCTATGGTGGCTGATTGACCGGAGCAAAG
TCGGCCTGCTCCTTTCGGCGGGAGTGGGCGTGGCTGGATCGGTAGTGCTCCTCAGCGTGAACCCGAGCATGATGC
CCGCACCGAGCAGAGCACTGCCGCACGCATTGGCCGGGCGCAACATGTCAGCATCGTCCATGGTGCACGGTATGC
CCTCGGCCGTTCTGGGGGGGCTGGCCAGCCGAGAGACTGTCGAGACGGGCATATGGATGCTCAGCGTACTGTTCA
ACAGCTGCGTGTGTTTCGGAAACATTGGGAGGCGGTTGGCGTTGAACGAAAAGGCCGGTGTCAGAGGGCGTTGGG
GAGGCGTCCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail