Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|4100
Gene name
Locationscaffold_320:18428..19610
Strand+
Gene length (bp)1182
Transcript length (bp)1182
Coding sequence length (bp)1179
Protein length (aa) 393

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 1.6E-11 14 60
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 7.1E-06 67 108
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 1.3E-10 17 73

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13493|MYB1_NEUCR Myb-like DNA-binding protein myb-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rca-1 PE=3 SV=2 10 134 7.0E-37
sp|P01103|MYB_CHICK Transcriptional activator Myb OS=Gallus gallus GN=MYB PE=1 SV=1 6 152 7.0E-23
sp|P01104|MYB_AVIMB Transforming protein Myb OS=Avian myeloblastosis virus GN=V-MYB PE=1 SV=2 6 152 1.0E-22
sp|P48972|MYBB_MOUSE Myb-related protein B OS=Mus musculus GN=Mybl2 PE=1 SV=1 9 114 1.0E-22
sp|P10244|MYBB_HUMAN Myb-related protein B OS=Homo sapiens GN=MYBL2 PE=1 SV=1 9 114 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13493|MYB1_NEUCR Myb-like DNA-binding protein myb-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rca-1 PE=3 SV=2 10 134 7.0E-37
sp|P01103|MYB_CHICK Transcriptional activator Myb OS=Gallus gallus GN=MYB PE=1 SV=1 6 152 7.0E-23
sp|P01104|MYB_AVIMB Transforming protein Myb OS=Avian myeloblastosis virus GN=V-MYB PE=1 SV=2 6 152 1.0E-22
sp|P48972|MYBB_MOUSE Myb-related protein B OS=Mus musculus GN=Mybl2 PE=1 SV=1 9 114 1.0E-22
sp|P10244|MYBB_HUMAN Myb-related protein B OS=Homo sapiens GN=MYBL2 PE=1 SV=1 9 114 1.0E-22
sp|P52551|MYBB_XENLA Myb-related protein B OS=Xenopus laevis GN=mybl2 PE=2 SV=2 10 114 2.0E-22
sp|Q03237|MYBB_CHICK Myb-related protein B OS=Gallus gallus GN=MYBL2 PE=1 SV=1 9 114 3.0E-22
sp|P10242|MYB_HUMAN Transcriptional activator Myb OS=Homo sapiens GN=MYB PE=1 SV=2 6 128 1.0E-21
sp|P06876|MYB_MOUSE Transcriptional activator Myb OS=Mus musculus GN=Myb PE=1 SV=2 6 154 1.0E-21
sp|P46200|MYB_BOVIN Transcriptional activator Myb OS=Bos taurus GN=MYB PE=2 SV=1 6 128 2.0E-21
sp|Q08759|MYB_XENLA Transcriptional activator Myb OS=Xenopus laevis GN=myb PE=2 SV=1 6 118 8.0E-21
sp|P10243|MYBA_HUMAN Myb-related protein A OS=Homo sapiens GN=MYBL1 PE=1 SV=2 6 114 3.0E-20
sp|P04197|MYB_DROME Myb protein OS=Drosophila melanogaster GN=Myb PE=1 SV=2 5 132 3.0E-20
sp|P51960|MYBA_MOUSE Myb-related protein A OS=Mus musculus GN=Mybl1 PE=1 SV=2 6 114 3.0E-20
sp|Q05935|MYBA_XENLA Myb-related protein A OS=Xenopus laevis GN=mybl1 PE=2 SV=1 10 114 5.0E-20
sp|P52550|MYBA_CHICK Myb-related protein A OS=Gallus gallus GN=MYBL1 PE=2 SV=1 6 136 7.0E-20
sp|Q9S7G7|MB3R1_ARATH Myb-related protein 3R-1 OS=Arabidopsis thaliana GN=MYB3R-1 PE=2 SV=1 6 119 1.0E-18
sp|Q9SJL7|RAX2_ARATH Transcription factor RAX2 OS=Arabidopsis thaliana GN=RAX2 PE=1 SV=1 11 108 2.0E-18
sp|Q9SPG3|MYB26_ARATH Transcription factor MYB26 OS=Arabidopsis thaliana GN=MYB26 PE=2 SV=1 12 114 2.0E-18
sp|P81396|MYB40_ANTMA Myb-related protein 340 OS=Antirrhinum majus GN=MYB340 PE=2 SV=1 4 126 4.0E-18
sp|Q9S7L2|MYB98_ARATH Transcription factor MYB98 OS=Arabidopsis thaliana GN=MYB98 PE=2 SV=1 12 114 5.0E-18
sp|Q9M2Y9|RAX3_ARATH Transcription factor RAX3 OS=Arabidopsis thaliana GN=RAX3 PE=2 SV=1 11 122 4.0E-17
sp|P81391|MYB05_ANTMA Myb-related protein 305 OS=Antirrhinum majus GN=MYB305 PE=2 SV=1 4 107 4.0E-17
sp|A2WW87|GAM1_ORYSI Transcription factor GAMYB OS=Oryza sativa subsp. indica GN=GAM1 PE=2 SV=1 10 116 7.0E-17
sp|P34127|MYBA_DICDI Myb-like protein A OS=Dictyostelium discoideum GN=mybA PE=3 SV=2 10 113 8.0E-17
sp|Q0JIC2|GAM1_ORYSJ Transcription factor GAMYB OS=Oryza sativa subsp. japonica GN=GAM1 PE=2 SV=1 10 116 8.0E-17
sp|Q9FDW1|MYB44_ARATH Transcription factor MYB44 OS=Arabidopsis thaliana GN=MYB44 PE=2 SV=1 11 114 9.0E-17
sp|Q54HP1|MYBQ_DICDI Myb-like protein Q OS=Dictyostelium discoideum GN=mybQ PE=3 SV=1 10 108 2.0E-16
sp|Q9FG68|RAX1_ARATH Transcription factor RAX1 OS=Arabidopsis thaliana GN=RAX1 PE=2 SV=1 12 117 3.0E-16
sp|Q9LK95|MYB21_ARATH Transcription factor MYB21 OS=Arabidopsis thaliana GN=MYB21 PE=1 SV=1 8 107 5.0E-16
sp|Q9SPG9|MYB24_ARATH Transcription factor MYB24 OS=Arabidopsis thaliana GN=MYB24 PE=1 SV=1 9 107 6.0E-16
sp|P80073|MYB2_PHYPA Myb-related protein Pp2 OS=Physcomitrella patens subsp. patens GN=PP2 PE=2 SV=1 12 116 8.0E-16
sp|P20024|MYB1_MAIZE Myb-related protein Zm1 OS=Zea mays PE=2 SV=1 12 133 1.0E-15
sp|Q9SSA1|MYB57_ARATH Transcription factor MYB57 OS=Arabidopsis thaliana GN=MYB57 PE=2 SV=1 8 119 3.0E-15
sp|P27900|GL1_ARATH Trichome differentiation protein GL1 OS=Arabidopsis thaliana GN=GL1 PE=1 SV=2 6 114 4.0E-15
sp|Q96276|MYB23_ARATH Transcription factor MYB23 OS=Arabidopsis thaliana GN=MYB23 PE=1 SV=1 8 133 4.0E-15
sp|Q38850|MYB5_ARATH Transcription repressor MYB5 OS=Arabidopsis thaliana GN=MYB5 PE=1 SV=1 12 117 5.0E-15
sp|Q947R4|GL1_ARALY Trichome differentiation protein GL1 OS=Arabidopsis lyrata GN=GL1 PE=3 SV=2 6 108 8.0E-15
sp|Q53NK6|MYBA1_ORYSJ Myb-related protein MYBAS1 OS=Oryza sativa subsp. japonica GN=MYBAS1 PE=2 SV=1 11 121 9.0E-15
sp|Q4JL84|MYB59_ARATH Transcription factor MYB59 OS=Arabidopsis thaliana GN=MYB59 PE=2 SV=2 6 122 1.0E-14
sp|Q9LX82|MYB48_ARATH Transcription factor MYB48 OS=Arabidopsis thaliana GN=MYB48 PE=2 SV=1 7 122 3.0E-14
sp|Q9SPG2|MYB28_ARATH Transcription factor MYB28 OS=Arabidopsis thaliana GN=MYB28 PE=1 SV=1 12 154 4.0E-14
sp|B0G0Y5|MYBAA_DICDI Myb-like protein AA OS=Dictyostelium discoideum GN=mybAA PE=3 SV=1 14 114 4.0E-14
sp|O64399|MYB34_ARATH Transcription factor MYB34 OS=Arabidopsis thaliana GN=MYB34 PE=1 SV=1 12 149 4.0E-14
sp|Q9LTF7|MYB82_ARATH Transcription factor MYB82 OS=Arabidopsis thaliana GN=MYB82 PE=1 SV=1 12 124 4.0E-14
sp|Q38851|MYB6_ARATH Transcription repressor MYB6 OS=Arabidopsis thaliana GN=MYB6 PE=1 SV=1 14 114 5.0E-14
sp|Q7XBH4|MYB4_ORYSJ Myb-related protein Myb4 OS=Oryza sativa subsp. japonica GN=MYB4 PE=2 SV=2 12 124 6.0E-14
sp|Q9SPG5|MYB76_ARATH Transcription factor MYB76 OS=Arabidopsis thaliana GN=MYB76 PE=1 SV=1 12 114 7.0E-14
sp|P81394|MYB15_ANTMA Myb-related protein 315 OS=Antirrhinum majus GN=MYB315 PE=2 SV=1 12 117 7.0E-14
sp|Q8LPH6|MYB86_ARATH Transcription factor MYB86 OS=Arabidopsis thaliana GN=MYB86 PE=2 SV=1 12 123 7.0E-14
sp|Q4JL76|MYBA2_ORYSJ Myb-related protein MYBAS2 OS=Oryza sativa subsp. japonica GN=MYBAS2 PE=2 SV=1 11 121 8.0E-14
sp|Q50EX6|ODO1_PETHY Protein ODORANT1 OS=Petunia hybrida GN=ODO1 PE=2 SV=1 12 173 8.0E-14
sp|P20025|MYB38_MAIZE Myb-related protein Zm38 OS=Zea mays PE=2 SV=1 14 117 1.0E-13
sp|P20027|MYB3_HORVU Myb-related protein Hv33 OS=Hordeum vulgare GN=MYB2 PE=2 SV=3 2 116 1.0E-13
sp|Q8GWP0|MYB39_ARATH Transcription factor MYB39 OS=Arabidopsis thaliana GN=MYB39 PE=2 SV=1 3 118 2.0E-13
sp|Q9LSI7|MYB35_ARATH Transcription factor MYB35 OS=Arabidopsis thaliana GN=MYB35 PE=2 SV=1 11 108 2.0E-13
sp|Q9SZP1|MYB4_ARATH Transcription repressor MYB4 OS=Arabidopsis thaliana GN=MYB4 PE=1 SV=1 14 114 2.0E-13
sp|Q9SEI0|WER_ARATH Transcription factor WER OS=Arabidopsis thaliana GN=WER PE=1 SV=1 9 108 3.0E-13
sp|P81392|MYB06_ANTMA Myb-related protein 306 OS=Antirrhinum majus GN=MYB306 PE=2 SV=1 12 118 5.0E-13
sp|P27898|MYBP_MAIZE Myb-related protein P OS=Zea mays GN=P PE=2 SV=1 12 125 5.0E-13
sp|P81395|MYB30_ANTMA Myb-related protein 330 OS=Antirrhinum majus GN=MYB330 PE=2 SV=1 14 114 6.0E-13
sp|O22264|MYB12_ARATH Transcription factor MYB12 OS=Arabidopsis thaliana GN=MYB12 PE=2 SV=1 12 114 6.0E-13
sp|Q9FJA2|TT2_ARATH Transcription factor TT2 OS=Arabidopsis thaliana GN=TT2 PE=1 SV=1 3 117 7.0E-13
sp|P81393|MYB08_ANTMA Myb-related protein 308 OS=Antirrhinum majus GN=MYB308 PE=2 SV=1 14 120 7.0E-13
sp|Q9LXV2|MYB46_ARATH Transcription factor MYB46 OS=Arabidopsis thaliana GN=MYB46 PE=2 SV=1 12 116 1.0E-12
sp|Q9FLR1|MYB29_ARATH Transcription factor MYB29 OS=Arabidopsis thaliana GN=MYB29 PE=1 SV=1 12 108 1.0E-12
sp|P20026|MYB1_HORVU Myb-related protein Hv1 OS=Hordeum vulgare GN=MYB1 PE=2 SV=1 14 120 2.0E-12
sp|Q9S9K9|MYB3_ARATH Transcription factor MYB3 OS=Arabidopsis thaliana GN=MYB3 PE=1 SV=1 12 114 3.0E-12
sp|Q9FNV9|MY113_ARATH Transcription factor MYB113 OS=Arabidopsis thaliana GN=MYB113 PE=1 SV=1 12 114 4.0E-12
sp|O49608|MYB32_ARATH Transcription factor MYB32 OS=Arabidopsis thaliana GN=MYB32 PE=2 SV=1 14 114 6.0E-12
sp|P10290|MYBC_MAIZE Anthocyanin regulatory C1 protein OS=Zea mays GN=C1 PE=2 SV=1 12 108 2.0E-11
sp|Q9SM27|MY104_ARATH Transcription factor MYB104 OS=Arabidopsis thaliana GN=MYB104 PE=2 SV=3 12 120 2.0E-11
sp|Q9FE25|MYB75_ARATH Transcription factor MYB75 OS=Arabidopsis thaliana GN=MYB75 PE=1 SV=1 12 159 2.0E-11
sp|Q9SCU7|MYB30_ARATH Transcription factor MYB30 OS=Arabidopsis thaliana GN=MYB30 PE=1 SV=1 12 114 2.0E-11
sp|P06876|MYB_MOUSE Transcriptional activator Myb OS=Mus musculus GN=Myb PE=1 SV=2 17 112 5.0E-11
sp|O49782|MYB51_ARATH Transcription factor MYB51 OS=Arabidopsis thaliana GN=MYB51 PE=1 SV=2 3 114 6.0E-11
sp|P52550|MYBA_CHICK Myb-related protein A OS=Gallus gallus GN=MYBL1 PE=2 SV=1 14 112 1.0E-10
sp|P10243|MYBA_HUMAN Myb-related protein A OS=Homo sapiens GN=MYBL1 PE=1 SV=2 14 112 1.0E-10
sp|P51960|MYBA_MOUSE Myb-related protein A OS=Mus musculus GN=Mybl1 PE=1 SV=2 14 112 1.0E-10
sp|Q08759|MYB_XENLA Transcriptional activator Myb OS=Xenopus laevis GN=myb PE=2 SV=1 17 112 2.0E-10
sp|Q8BP86|SNPC4_MOUSE snRNA-activating protein complex subunit 4 OS=Mus musculus GN=Snapc4 PE=1 SV=2 9 123 2.0E-10
sp|P34127|MYBA_DICDI Myb-like protein A OS=Dictyostelium discoideum GN=mybA PE=3 SV=2 17 112 3.0E-10
sp|Q9M0K4|LAF1_ARATH Transcription factor LAF1 OS=Arabidopsis thaliana GN=LAF1 PE=1 SV=2 13 120 3.0E-10
sp|Q9LDE1|MY108_ARATH Transcription factor MYB108 OS=Arabidopsis thaliana GN=MYB108 PE=1 SV=1 5 107 4.0E-10
sp|Q54NA6|MYBL_DICDI Myb-like protein L OS=Dictyostelium discoideum GN=mybL PE=3 SV=1 9 101 5.0E-10
sp|Q05935|MYBA_XENLA Myb-related protein A OS=Xenopus laevis GN=mybl1 PE=2 SV=1 9 112 2.0E-09
sp|M1ETK3|MYB1W_BETVU Transcription factor MYB1 OS=Beta vulgaris GN=MYB1 PE=2 SV=1 12 119 3.0E-09
sp|M1ETA5|MYB1R_BETVU Transcription factor MYB1 OS=Beta vulgaris GN=MYB1 PE=1 SV=1 12 119 3.0E-09
sp|Q9FNV8|MY114_ARATH Transcription factor MYB114 OS=Arabidopsis thaliana GN=MYB114 PE=1 SV=1 12 108 7.0E-09
sp|Q9ZTC3|MYB90_ARATH Transcription factor MYB90 OS=Arabidopsis thaliana GN=MYB90 PE=1 SV=1 12 108 4.0E-08
sp|Q9C9C8|MY122_ARATH Transcription factor MYB122 OS=Arabidopsis thaliana GN=MYB122 PE=1 SV=1 12 108 4.0E-08
sp|O80931|AS1_ARATH Transcription factor AS1 OS=Arabidopsis thaliana GN=AS1 PE=1 SV=1 14 119 1.0E-06
sp|Q6FUG1|CEF1_CANGA Pre-mRNA-splicing factor CEF1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CEF1 PE=3 SV=1 12 98 2.0E-06
sp|Q54NA6|MYBL_DICDI Myb-like protein L OS=Dictyostelium discoideum GN=mybL PE=3 SV=1 17 100 3.0E-06
sp|P22035|BAS1_YEAST Myb-like DNA-binding protein BAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BAS1 PE=1 SV=1 9 132 8.0E-06
sp|P91868|SNPC4_CAEEL snRNA-activating protein complex subunit 4 homolog OS=Caenorhabditis elegans GN=snpc-4 PE=2 SV=1 17 120 9.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4342 0.8961 0.0059 0.0284 0.1053 0.0013 0.0169 0.0344 0.0044 0.0588

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5118
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6901
Ophiocordyceps australis map64 (Brazil) OphauB2|4589
Ophiocordyceps camponoti-floridani Ophcf2|06081
Ophiocordyceps camponoti-rufipedis Ophun1|879
Ophiocordyceps kimflemingae Ophio5|4100 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3373

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|4100
MPAPSQMPDPDIRRGPWSTAEDKRLLELINHQTGVNWVRISGFLSSRSAKQCRERYHQNLKPSLNHGPITPEEGV
VIDQLVETIGRRWAEIARRLKGRSDNAVKNWWNGNQNRRKRLESRRRGAGAGSPTSAPGPAYRQPTPRMMVNQPS
GPPSHDAQPQGALTFPGSSAAGEAYTQPNPNMQPRPGVPTFHDELAHRDLALRGLTAPSAHSSHEVQPQAAAFDD
NRRPRAALPSLASPLGLPWPPTSPVTDSYSFNHHYRHGDMPLPSPCSSEPPESDMGSYYTFSPSQDRNCMELPPL
RTQLPRTRLPPTYNHESLPSLRNWTSKDDRSEPFNDPRPQLLPTGVPDRLSLPAAVWQPPTAPSSPLQSQERQQQ
QSSAGNKDSRMKLAALLG
Coding >Ophio5|4100
ATGCCAGCTCCAAGCCAAATGCCCGATCCTGACATCAGGAGAGGCCCATGGTCCACTGCCGAGGACAAGAGGCTT
TTAGAACTAATCAATCATCAAACCGGCGTCAACTGGGTTCGCATCTCTGGTTTCCTTTCCTCACGCAGCGCAAAA
CAGTGCCGCGAGCGATATCATCAAAATCTCAAGCCGTCCCTGAATCACGGGCCCATTACTCCCGAAGAGGGCGTG
GTGATTGATCAACTGGTCGAAACCATCGGCAGACGATGGGCTGAGATCGCTCGTAGGCTGAAGGGCCGAAGCGAC
AATGCCGTCAAGAATTGGTGGAACGGCAACCAAAACCGCCGCAAACGCCTGGAGAGCCGTCGGCGTGGAGCCGGG
GCCGGATCACCAACATCGGCACCGGGTCCGGCATACAGGCAGCCAACCCCCAGGATGATGGTAAACCAGCCTAGC
GGACCGCCTTCGCATGACGCTCAACCTCAAGGTGCCCTCACCTTTCCTGGGTCATCAGCAGCGGGTGAGGCATAC
ACGCAACCAAACCCCAACATGCAGCCTCGGCCAGGGGTACCGACTTTTCACGATGAATTGGCCCATCGTGATTTG
GCCCTTCGAGGATTAACGGCACCGTCCGCACACTCATCTCACGAGGTTCAGCCGCAAGCAGCGGCTTTCGACGAC
AACCGGCGTCCTCGCGCGGCCCTTCCGTCCTTGGCGAGTCCCCTGGGCCTACCTTGGCCGCCGACCTCCCCTGTG
ACGGATTCTTACAGCTTCAACCACCATTACCGTCACGGGGATATGCCTCTACCCTCTCCTTGCTCGTCTGAACCC
CCGGAGTCAGACATGGGATCATATTACACATTTTCGCCTAGTCAGGACCGCAATTGCATGGAGTTACCGCCGTTG
CGCACGCAGCTGCCCCGGACTCGGCTGCCCCCGACCTACAACCACGAAAGCCTCCCGAGTCTCAGGAATTGGACC
TCAAAAGATGATAGGAGCGAACCTTTCAATGATCCGCGCCCACAACTGCTTCCAACTGGGGTCCCGGATAGACTG
TCGCTCCCGGCAGCCGTTTGGCAACCACCAACGGCGCCCAGCTCGCCGTTGCAAAGCCAGGAGAGGCAGCAGCAG
CAGTCAAGCGCGGGGAATAAGGATTCGCGCATGAAATTGGCGGCATTGCTAGGG
Transcript >Ophio5|4100
ATGCCAGCTCCAAGCCAAATGCCCGATCCTGACATCAGGAGAGGCCCATGGTCCACTGCCGAGGACAAGAGGCTT
TTAGAACTAATCAATCATCAAACCGGCGTCAACTGGGTTCGCATCTCTGGTTTCCTTTCCTCACGCAGCGCAAAA
CAGTGCCGCGAGCGATATCATCAAAATCTCAAGCCGTCCCTGAATCACGGGCCCATTACTCCCGAAGAGGGCGTG
GTGATTGATCAACTGGTCGAAACCATCGGCAGACGATGGGCTGAGATCGCTCGTAGGCTGAAGGGCCGAAGCGAC
AATGCCGTCAAGAATTGGTGGAACGGCAACCAAAACCGCCGCAAACGCCTGGAGAGCCGTCGGCGTGGAGCCGGG
GCCGGATCACCAACATCGGCACCGGGTCCGGCATACAGGCAGCCAACCCCCAGGATGATGGTAAACCAGCCTAGC
GGACCGCCTTCGCATGACGCTCAACCTCAAGGTGCCCTCACCTTTCCTGGGTCATCAGCAGCGGGTGAGGCATAC
ACGCAACCAAACCCCAACATGCAGCCTCGGCCAGGGGTACCGACTTTTCACGATGAATTGGCCCATCGTGATTTG
GCCCTTCGAGGATTAACGGCACCGTCCGCACACTCATCTCACGAGGTTCAGCCGCAAGCAGCGGCTTTCGACGAC
AACCGGCGTCCTCGCGCGGCCCTTCCGTCCTTGGCGAGTCCCCTGGGCCTACCTTGGCCGCCGACCTCCCCTGTG
ACGGATTCTTACAGCTTCAACCACCATTACCGTCACGGGGATATGCCTCTACCCTCTCCTTGCTCGTCTGAACCC
CCGGAGTCAGACATGGGATCATATTACACATTTTCGCCTAGTCAGGACCGCAATTGCATGGAGTTACCGCCGTTG
CGCACGCAGCTGCCCCGGACTCGGCTGCCCCCGACCTACAACCACGAAAGCCTCCCGAGTCTCAGGAATTGGACC
TCAAAAGATGATAGGAGCGAACCTTTCAATGATCCGCGCCCACAACTGCTTCCAACTGGGGTCCCGGATAGACTG
TCGCTCCCGGCAGCCGTTTGGCAACCACCAACGGCGCCCAGCTCGCCGTTGCAAAGCCAGGAGAGGCAGCAGCAG
CAGTCAAGCGCGGGGAATAAGGATTCGCGCATGAAATTGGCGGCATTGCTAGGGTGA
Gene >Ophio5|4100
ATGCCAGCTCCAAGCCAAATGCCCGATCCTGACATCAGGAGAGGCCCATGGTCCACTGCCGAGGACAAGAGGCTT
TTAGAACTAATCAATCATCAAACCGGCGTCAACTGGGTTCGCATCTCTGGTTTCCTTTCCTCACGCAGCGCAAAA
CAGTGCCGCGAGCGATATCATCAAAATCTCAAGCCGTCCCTGAATCACGGGCCCATTACTCCCGAAGAGGGCGTG
GTGATTGATCAACTGGTCGAAACCATCGGCAGACGATGGGCTGAGATCGCTCGTAGGCTGAAGGGCCGAAGCGAC
AATGCCGTCAAGAATTGGTGGAACGGCAACCAAAACCGCCGCAAACGCCTGGAGAGCCGTCGGCGTGGAGCCGGG
GCCGGATCACCAACATCGGCACCGGGTCCGGCATACAGGCAGCCAACCCCCAGGATGATGGTAAACCAGCCTAGC
GGACCGCCTTCGCATGACGCTCAACCTCAAGGTGCCCTCACCTTTCCTGGGTCATCAGCAGCGGGTGAGGCATAC
ACGCAACCAAACCCCAACATGCAGCCTCGGCCAGGGGTACCGACTTTTCACGATGAATTGGCCCATCGTGATTTG
GCCCTTCGAGGATTAACGGCACCGTCCGCACACTCATCTCACGAGGTTCAGCCGCAAGCAGCGGCTTTCGACGAC
AACCGGCGTCCTCGCGCGGCCCTTCCGTCCTTGGCGAGTCCCCTGGGCCTACCTTGGCCGCCGACCTCCCCTGTG
ACGGATTCTTACAGCTTCAACCACCATTACCGTCACGGGGATATGCCTCTACCCTCTCCTTGCTCGTCTGAACCC
CCGGAGTCAGACATGGGATCATATTACACATTTTCGCCTAGTCAGGACCGCAATTGCATGGAGTTACCGCCGTTG
CGCACGCAGCTGCCCCGGACTCGGCTGCCCCCGACCTACAACCACGAAAGCCTCCCGAGTCTCAGGAATTGGACC
TCAAAAGATGATAGGAGCGAACCTTTCAATGATCCGCGCCCACAACTGCTTCCAACTGGGGTCCCGGATAGACTG
TCGCTCCCGGCAGCCGTTTGGCAACCACCAACGGCGCCCAGCTCGCCGTTGCAAAGCCAGGAGAGGCAGCAGCAG
CAGTCAAGCGCGGGGAATAAGGATTCGCGCATGAAATTGGCGGCATTGCTAGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail